BLASTX nr result
ID: Ophiopogon24_contig00022206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022206 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial is... 55 1e-06 ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial is... 54 3e-06 >ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial isoform X1 [Asparagus officinalis] Length = 170 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 294 EQVVSPGSVYQQCLKYLTTGNSDTHEDF*PTNKIERSG 407 +QV S GSV QQ L+Y T G+SDTH+DF PT+KIERSG Sbjct: 23 KQVASSGSVLQQGLRYSTAGDSDTHDDFKPTSKIERSG 60 >ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial isoform X2 [Asparagus officinalis] gb|ONK59502.1| uncharacterized protein A4U43_C08F7090 [Asparagus officinalis] Length = 169 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 285 NIFEQVVSPGSVYQQCLKYLTTGNSDTHEDF*PTNKIERSG 407 ++ +V S GSV QQ L+Y T G+SDTH+DF PT+KIERSG Sbjct: 19 SLMSKVASSGSVLQQGLRYSTAGDSDTHDDFKPTSKIERSG 59