BLASTX nr result
ID: Ophiopogon24_contig00022108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022108 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022845074.1| protein MICRORCHIDIA 6 isoform X2 [Olea euro... 55 8e-06 ref|XP_022845072.1| protein MICRORCHIDIA 6 isoform X1 [Olea euro... 55 8e-06 >ref|XP_022845074.1| protein MICRORCHIDIA 6 isoform X2 [Olea europaea var. sylvestris] Length = 653 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 109 SSLQNMVKIVCVHPKFLHLHATSHKWAFSALAELLD 2 S+LQN + +HPKFLH +ATSHKWAF A+AELLD Sbjct: 114 STLQNGTSYLHIHPKFLHSNATSHKWAFGAIAELLD 149 >ref|XP_022845072.1| protein MICRORCHIDIA 6 isoform X1 [Olea europaea var. sylvestris] ref|XP_022845073.1| protein MICRORCHIDIA 6 isoform X1 [Olea europaea var. sylvestris] Length = 669 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 109 SSLQNMVKIVCVHPKFLHLHATSHKWAFSALAELLD 2 S+LQN + +HPKFLH +ATSHKWAF A+AELLD Sbjct: 114 STLQNGTSYLHIHPKFLHSNATSHKWAFGAIAELLD 149