BLASTX nr result
ID: Ophiopogon24_contig00022058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00022058 (916 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018781912.1| PREDICTED: putative uncharacterized protein ... 60 3e-07 >ref|XP_018781912.1| PREDICTED: putative uncharacterized protein DDB_G0290521, partial [Serinus canaria] Length = 185 Score = 60.5 bits (145), Expect = 3e-07 Identities = 50/122 (40%), Positives = 66/122 (54%), Gaps = 1/122 (0%) Frame = -2 Query: 873 SLYLSQSLFPLQANELNPKLSL*ISQHPSFSIFSALSLSPPFRFGTGP*T*TKSLTLDPT 694 SL LS SL P + +P LS +S PS S+ +L+LSP + SL+L P Sbjct: 68 SLSLSLSLSPSPSLSPSPSLSPSLSPSPSPSLSPSLALSPSLSLSL-----SLSLSLSPA 122 Query: 693 LTVSPLSAPCLSPVGLTSLRPKLCPSISLSLSHN-STTAALSPCLQSALPTLWPSTTAAP 517 L+ SP +P LSP SL P L PS SLSLS + S + +LSP L +L PS + +P Sbjct: 123 LSPSPSLSPSLSPSLSLSLSPSLSPSPSLSLSLSPSLSLSLSPSLSLSLS---PSLSLSP 179 Query: 516 LL 511 L Sbjct: 180 SL 181