BLASTX nr result
ID: Ophiopogon24_contig00021636
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00021636 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWM78385.1| hypothetical protein CDL15_Pgr016109 [Punica gran... 55 8e-06 >gb|OWM78385.1| hypothetical protein CDL15_Pgr016109 [Punica granatum] gb|PKI31894.1| hypothetical protein CRG98_047704 [Punica granatum] Length = 1473 Score = 55.1 bits (131), Expect = 8e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Frame = +1 Query: 253 QKYLIKKLESDNSKLNNKVRFINNVRGGKITINQ----SLSLQLQRNGFTPFPMKTKDI 417 +K+L+ LE + KL+NKVRFI V G+I +N L ++LQ GFTPFP KTK I Sbjct: 1026 KKFLLDNLEMELLKLDNKVRFILGVVNGEIIVNNRKRAELFIELQEKGFTPFPKKTKSI 1084