BLASTX nr result
ID: Ophiopogon24_contig00021604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00021604 (963 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274931.1| LOW QUALITY PROTEIN: uncharacterized protein... 64 2e-07 >ref|XP_020274931.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109849498 [Asparagus officinalis] Length = 1213 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 961 KAQQSNNEKLLENPYLQMRGILKLLNDPGA 872 KAQQSNNEKLLENPYLQMRGILKLLNDPGA Sbjct: 1184 KAQQSNNEKLLENPYLQMRGILKLLNDPGA 1213