BLASTX nr result
ID: Ophiopogon24_contig00021333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00021333 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256590.1| pentatricopeptide repeat-containing protein ... 83 3e-15 gb|ONK74770.1| uncharacterized protein A4U43_C03F9970 [Asparagus... 83 3e-15 ref|XP_008803207.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_010930804.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_020674226.1| pentatricopeptide repeat-containing protein ... 60 4e-07 gb|PKA49430.1| Pentatricopeptide repeat-containing protein [Apos... 56 9e-06 >ref|XP_020256590.1| pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Asparagus officinalis] Length = 529 Score = 83.2 bits (204), Expect = 3e-15 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 RHGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKTYMRLFK 155 R+GLEPN AIY +I GLCK+G+MDRAL FM EMT KGHQ NAKTYMRLFK Sbjct: 479 RYGLEPNMAIYTTMIFGLCKSGDMDRALHFMKEMTEKGHQPNAKTYMRLFK 529 >gb|ONK74770.1| uncharacterized protein A4U43_C03F9970 [Asparagus officinalis] Length = 573 Score = 83.2 bits (204), Expect = 3e-15 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 RHGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKTYMRLFK 155 R+GLEPN AIY +I GLCK+G+MDRAL FM EMT KGHQ NAKTYMRLFK Sbjct: 523 RYGLEPNMAIYTTMIFGLCKSGDMDRALHFMKEMTEKGHQPNAKTYMRLFK 573 >ref|XP_008803207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Phoenix dactylifera] ref|XP_008803208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Phoenix dactylifera] Length = 552 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +3 Query: 3 RHGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKT 137 RHG EPN+ IY ML+ GLCKAGN DRA ++ EM+ KG Q+NAKT Sbjct: 485 RHGFEPNSVIYNMLVYGLCKAGNFDRAEHYLEEMSHKGQQVNAKT 529 >ref|XP_010930804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial [Elaeis guineensis] Length = 554 Score = 63.2 bits (152), Expect = 3e-08 Identities = 34/70 (48%), Positives = 44/70 (62%) Frame = +3 Query: 3 RHGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKTYMRLFK*NVHGEESL 182 RHGLEPN+ I+ L+ GLCKAGN RA ++ EM+ KG Q+NAKT+ L N Sbjct: 485 RHGLEPNSVIFNKLVYGLCKAGNFGRAEYYLEEMSRKGQQVNAKTHHILS--NGRAGRFQ 542 Query: 183 TCKELALSCG 212 ++LA SCG Sbjct: 543 DAEKLAPSCG 552 >ref|XP_020674226.1| pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Dendrobium catenatum] gb|PKU65504.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 560 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/51 (47%), Positives = 40/51 (78%) Frame = +3 Query: 3 RHGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKTYMRLFK 155 + GLEPN+AIY MLIC LC AG++++A+ F+ EM++KG +L+ ++ +F+ Sbjct: 490 KQGLEPNSAIYTMLICSLCMAGSINKAIHFLEEMSLKGLKLDFRSIRMVFR 540 >gb|PKA49430.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 581 Score = 55.8 bits (133), Expect = 9e-06 Identities = 20/47 (42%), Positives = 36/47 (76%) Frame = +3 Query: 6 HGLEPNTAIYAMLICGLCKAGNMDRALRFMNEMTIKGHQLNAKTYMR 146 HG EP+++ + ++IC LCKAG+M++A+ F+ +M +KG +L+ K + R Sbjct: 511 HGFEPSSSFFTVIICSLCKAGSMEKAVMFLEDMCLKGQKLDFKLFFR 557