BLASTX nr result
ID: Ophiopogon24_contig00021067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00021067 (620 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259514.1| uncharacterized protein LOC109835968 [Aspara... 90 2e-19 >ref|XP_020259514.1| uncharacterized protein LOC109835968 [Asparagus officinalis] gb|ONK72304.1| uncharacterized protein A4U43_C04F17940 [Asparagus officinalis] Length = 146 Score = 90.1 bits (222), Expect = 2e-19 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = -3 Query: 456 TYTSAVCIVAREIHTEGQNNQHEVEKKLLEGTGKVKGTLEYSGSPVDSHHTIPRNQW 286 TY SAVC +A E+HT+ QN QHEVEKKLLE TGKVK LEYSGS VD+HH IPRNQ+ Sbjct: 59 TYGSAVCTLAIEVHTDAQNYQHEVEKKLLEETGKVKAALEYSGSTVDNHHNIPRNQY 115