BLASTX nr result
ID: Ophiopogon24_contig00020887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020887 (729 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024025923.1| carboxyl-terminal-processing peptidase 2, ch... 57 9e-06 >ref|XP_024025923.1| carboxyl-terminal-processing peptidase 2, chloroplastic isoform X2 [Morus notabilis] Length = 428 Score = 57.0 bits (136), Expect = 9e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +3 Query: 114 KGVITYIWDNRGFRNIYEVDGGDTVATSDPLVVLVCSFCH 233 KGVI YI DNRG R++Y+ DGG +A S+PL VLVC H Sbjct: 382 KGVIVYICDNRGVRDVYDTDGGSAIAPSEPLAVLVCEIYH 421