BLASTX nr result
ID: Ophiopogon24_contig00020829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020829 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020583646.1| UBP1-associated protein 2C-like [Phalaenopsi... 54 7e-06 >ref|XP_020583646.1| UBP1-associated protein 2C-like [Phalaenopsis equestris] ref|XP_020583647.1| UBP1-associated protein 2C-like [Phalaenopsis equestris] ref|XP_020583649.1| UBP1-associated protein 2C-like [Phalaenopsis equestris] Length = 456 Score = 54.3 bits (129), Expect = 7e-06 Identities = 35/97 (36%), Positives = 43/97 (44%), Gaps = 4/97 (4%) Frame = -1 Query: 386 ALDGKK-KPGM---GENKPAPGVENIKQPGEGFGAGFGSQSSMPGSLGNQXXXXXXXXXX 219 A+DGKK KPG G P + I+ G G G G GSQSS PGS +Q Sbjct: 252 AIDGKKGKPGTAVSGSGAPGKPLGGIRADGLGDGLGMGSQSSTPGSFSSQFGGPGGGLSS 311 Query: 218 XXXXXXXXXXXXXXXXXXGTHHLNSPLQSSIGSGTTG 108 H+LN+PLQS++G G TG Sbjct: 312 YGGFSGGGGYPVVATGIGHNHNLNTPLQSAVGLGNTG 348