BLASTX nr result
ID: Ophiopogon24_contig00020803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020803 (1152 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89952.1| hypothetical protein L484_023604 [Morus notabilis] 49 4e-08 >gb|EXB89952.1| hypothetical protein L484_023604 [Morus notabilis] Length = 545 Score = 48.9 bits (115), Expect(2) = 4e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 1119 SPLSRRFLADKKPPTWMVAQAI 1054 SPLSRRFLADKKPPTWMVAQAI Sbjct: 301 SPLSRRFLADKKPPTWMVAQAI 322 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 1070 WLRRQSS-ILIGPSREVEATSHSSHGKIPPCHA*GMEHVTPSVSGFCEARATASLKEK 900 W+ Q+ ILIGPSREVEATSH I +TP GFC + + +L +K Sbjct: 316 WMVAQAIFILIGPSREVEATSHLLPSPI----------ITPGKMGFCRSNSLHTLAKK 363