BLASTX nr result
ID: Ophiopogon24_contig00020656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020656 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL69374.1|AF462211_1 putative pectinesterase, partial [Narci... 61 5e-10 ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fra... 67 5e-10 ref|XP_018821446.1| PREDICTED: pectin acetylesterase 8-like [Jug... 66 1e-09 ref|XP_021812222.1| pectin acetylesterase 8-like [Prunus avium] ... 65 1e-09 ref|XP_022737901.1| pectin acetylesterase 8-like isoform X3 [Dur... 65 1e-09 ref|XP_022737900.1| pectin acetylesterase 8-like isoform X2 [Dur... 65 1e-09 ref|XP_022737899.1| pectin acetylesterase 8-like isoform X1 [Dur... 65 1e-09 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] 65 2e-09 ref|XP_024031265.1| LOW QUALITY PROTEIN: pectin acetylesterase 8... 65 2e-09 gb|PON68582.1| Pectinacetylesterase/NOTUM [Parasponia andersonii] 65 2e-09 gb|PON41374.1| Pectinacetylesterase/NOTUM [Trema orientalis] 65 2e-09 ref|XP_018849186.1| PREDICTED: pectin acetylesterase 8-like [Jug... 64 3e-09 ref|XP_018832508.1| PREDICTED: pectin acetylesterase 8-like [Jug... 64 3e-09 gb|ACF05806.1| PAE [Litchi chinensis] 64 6e-09 ref|XP_018505030.1| PREDICTED: pectin acetylesterase 8-like isof... 64 6e-09 ref|XP_018505028.1| PREDICTED: pectin acetylesterase 8-like isof... 64 6e-09 ref|XP_018505027.1| PREDICTED: pectin acetylesterase 8-like isof... 64 7e-09 ref|XP_008373439.1| PREDICTED: pectin acetylesterase 8 isoform X... 64 7e-09 ref|XP_008373438.1| PREDICTED: pectin acetylesterase 8 isoform X... 64 7e-09 ref|XP_022136630.1| pectin acetylesterase 8-like isoform X2 [Mom... 63 9e-09 >gb|AAL69374.1|AF462211_1 putative pectinesterase, partial [Narcissus pseudonarcissus] Length = 47 Score = 61.2 bits (147), Expect = 5e-10 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSC 289 T+A+AVGNWFYDRSS QKIDCPYPC+ SC Sbjct: 13 TVAEAVGNWFYDRSSCQKIDCPYPCDTSC 41 >ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. vesca] Length = 399 Score = 66.6 bits (161), Expect = 5e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCYA 295 K TIA AVG+WFYDR+SFQKIDCPYPCNP+C+A Sbjct: 357 KTTIARAVGDWFYDRTSFQKIDCPYPCNPTCHA 389 >ref|XP_018821446.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 399 Score = 65.9 bits (159), Expect = 1e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 TIA AVGNWFYDRS FQKIDCPYPCNP+C+ Sbjct: 358 TIARAVGNWFYDRSPFQKIDCPYPCNPTCH 387 >ref|XP_021812222.1| pectin acetylesterase 8-like [Prunus avium] ref|XP_021812223.1| pectin acetylesterase 8-like [Prunus avium] Length = 400 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVGNWFYDR+ FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGNWFYDRTPFQKIDCPYPCNPTCH 387 >ref|XP_022737901.1| pectin acetylesterase 8-like isoform X3 [Durio zibethinus] ref|XP_022737902.1| pectin acetylesterase 8-like isoform X3 [Durio zibethinus] Length = 402 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 387 >ref|XP_022737900.1| pectin acetylesterase 8-like isoform X2 [Durio zibethinus] Length = 428 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 382 KTTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 413 >ref|XP_022737899.1| pectin acetylesterase 8-like isoform X1 [Durio zibethinus] Length = 454 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+SFQKIDCPYPCNP+C+ Sbjct: 408 KTTIAKAVGDWFYDRNSFQKIDCPYPCNPTCH 439 >gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis] Length = 386 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 TIA AVG+WFYDRS+FQKIDCPYPCNP+C+ Sbjct: 346 TIAKAVGDWFYDRSAFQKIDCPYPCNPTCH 375 >ref|XP_024031265.1| LOW QUALITY PROTEIN: pectin acetylesterase 8 [Morus notabilis] Length = 401 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 TIA AVG+WFYDRS+FQKIDCPYPCNP+C+ Sbjct: 361 TIAKAVGDWFYDRSAFQKIDCPYPCNPTCH 390 >gb|PON68582.1| Pectinacetylesterase/NOTUM [Parasponia andersonii] Length = 403 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 361 KTTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 392 >gb|PON41374.1| Pectinacetylesterase/NOTUM [Trema orientalis] Length = 403 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 361 KTTIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 392 >ref|XP_018849186.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 399 Score = 64.3 bits (155), Expect = 3e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 358 TIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 387 >ref|XP_018832508.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] ref|XP_018832514.1| PREDICTED: pectin acetylesterase 8-like [Juglans regia] Length = 400 Score = 64.3 bits (155), Expect = 3e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 203 TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 TIA AVG+WFYDRS FQKIDCPYPCNP+C+ Sbjct: 359 TIAKAVGDWFYDRSPFQKIDCPYPCNPTCH 388 >gb|ACF05806.1| PAE [Litchi chinensis] Length = 399 Score = 63.5 bits (153), Expect = 6e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+W+YDRS FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWYYDRSPFQKIDCPYPCNPTCH 387 >ref|XP_018505030.1| PREDICTED: pectin acetylesterase 8-like isoform X3 [Pyrus x bretschneideri] Length = 405 Score = 63.5 bits (153), Expect = 6e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ Sbjct: 323 KTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCH 354 >ref|XP_018505028.1| PREDICTED: pectin acetylesterase 8-like isoform X2 [Pyrus x bretschneideri] Length = 411 Score = 63.5 bits (153), Expect = 6e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCH 387 >ref|XP_018505027.1| PREDICTED: pectin acetylesterase 8-like isoform X1 [Pyrus x bretschneideri] ref|XP_018505029.1| PREDICTED: pectin acetylesterase 8-like isoform X1 [Pyrus x bretschneideri] Length = 438 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCH 387 >ref|XP_008373439.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_008373440.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_017188510.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] ref|XP_017188511.1| PREDICTED: pectin acetylesterase 8 isoform X2 [Malus domestica] Length = 438 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCH 387 >ref|XP_008373438.1| PREDICTED: pectin acetylesterase 8 isoform X1 [Malus domestica] Length = 466 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WFYDR+ FQKIDCPYPCNP+C+ Sbjct: 384 KTTIAKAVGDWFYDRTPFQKIDCPYPCNPTCH 415 >ref|XP_022136630.1| pectin acetylesterase 8-like isoform X2 [Momordica charantia] ref|XP_022136631.1| pectin acetylesterase 8-like isoform X2 [Momordica charantia] Length = 398 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 197 K*TIADAVGNWFYDRSSFQKIDCPYPCNPSCY 292 K TIA AVG+WF+DRS FQKIDCPYPCNP+C+ Sbjct: 356 KTTIAKAVGDWFFDRSPFQKIDCPYPCNPTCH 387