BLASTX nr result
ID: Ophiopogon24_contig00020551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020551 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253148.1| uncharacterized protein LOC109830320 isoform... 64 3e-09 ref|XP_020253145.1| uncharacterized protein LOC109830320 isoform... 64 3e-09 >ref|XP_020253148.1| uncharacterized protein LOC109830320 isoform X2 [Asparagus officinalis] Length = 803 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -2 Query: 377 LHRSLSSCKAVIQSIHRNVLNSLESSTCALTLEEKHSIQALFHQMK 240 LHRSLS C+ IQS+ + VL+ LESST AL LEEKHSIQ LFHQ+K Sbjct: 741 LHRSLSFCQEAIQSVLQKVLSLLESSTYALMLEEKHSIQTLFHQLK 786 >ref|XP_020253145.1| uncharacterized protein LOC109830320 isoform X1 [Asparagus officinalis] ref|XP_020253147.1| uncharacterized protein LOC109830320 isoform X1 [Asparagus officinalis] gb|ONK77458.1| uncharacterized protein A4U43_C02F6730 [Asparagus officinalis] Length = 887 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -2 Query: 377 LHRSLSSCKAVIQSIHRNVLNSLESSTCALTLEEKHSIQALFHQMK 240 LHRSLS C+ IQS+ + VL+ LESST AL LEEKHSIQ LFHQ+K Sbjct: 825 LHRSLSFCQEAIQSVLQKVLSLLESSTYALMLEEKHSIQTLFHQLK 870