BLASTX nr result
ID: Ophiopogon24_contig00020243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020243 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246822.1| LOW QUALITY PROTEIN: inositol transporter 1 ... 56 1e-06 >ref|XP_020246822.1| LOW QUALITY PROTEIN: inositol transporter 1 [Asparagus officinalis] Length = 506 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 274 MTILSMPVSSASNLDPSPKRSLSYFSNGYVLGLA 375 MTI+SMP SS SNLDPS RSLSYFSN YVLGLA Sbjct: 1 MTIMSMPSSSGSNLDPSRGRSLSYFSNSYVLGLA 34