BLASTX nr result
ID: Ophiopogon24_contig00020087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020087 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252526.1| histone acetyltransferase HAC1-like isoform ... 61 1e-07 ref|XP_020252523.1| histone acetyltransferase HAC1-like isoform ... 57 5e-06 >ref|XP_020252526.1| histone acetyltransferase HAC1-like isoform X2 [Asparagus officinalis] Length = 1714 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 428 MQNLGAFSMDHDLSVSRRKVQDTIQYLLRKQSNPYSDW 541 MQN+G++SMD DL +SR+K+QDTIQ LLR+QSNPY +W Sbjct: 1 MQNIGSYSMDPDLLMSRKKMQDTIQCLLRRQSNPYGEW 38 >ref|XP_020252523.1| histone acetyltransferase HAC1-like isoform X1 [Asparagus officinalis] ref|XP_020252524.1| histone acetyltransferase HAC1-like isoform X1 [Asparagus officinalis] gb|ONK76931.1| uncharacterized protein A4U43_C02F1370 [Asparagus officinalis] Length = 1715 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/39 (66%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 428 MQNLGAFSMDHDLSVSRRKVQDTI-QYLLRKQSNPYSDW 541 MQN+G++SMD DL +SR+K+QDTI Q LLR+QSNPY +W Sbjct: 1 MQNIGSYSMDPDLLMSRKKMQDTISQCLLRRQSNPYGEW 39