BLASTX nr result
ID: Ophiopogon24_contig00020025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00020025 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266939.1| PREDICTED: F-box protein SKIP23-like [Nelumb... 55 4e-06 >ref|XP_010266939.1| PREDICTED: F-box protein SKIP23-like [Nelumbo nucifera] Length = 388 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = -2 Query: 427 FFSISDKRIYKLRLPRGTQEKTYHGSPYGWLLTVNSDDRKQRVSLLNPITKAQVLLPPLT 248 FFS+SD +I+ L LP ++ + GS GWL+ V + + LLNP+T+AQ+ LPPLT Sbjct: 68 FFSLSDDKIHWLELPEASRRRRCCGSSQGWLVVV---EESPVIRLLNPLTRAQIQLPPLT 124