BLASTX nr result
ID: Ophiopogon24_contig00019611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00019611 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264152.1| methyltransferase-like protein 5 [Asparagus ... 64 8e-10 gb|ONK69210.1| uncharacterized protein A4U43_C05F20490 [Asparagu... 64 1e-09 ref|XP_023748001.1| methyltransferase-like protein 5 [Lactuca sa... 60 3e-09 ref|XP_023739187.1| methyltransferase-like protein 5 isoform X2 ... 60 1e-08 gb|KRH76308.1| hypothetical protein GLYMA_01G145300 [Glycine max] 60 2e-08 gb|KHN40126.1| Methyltransferase-like protein 5 [Glycine soja] 60 2e-08 ref|XP_023739181.1| methyltransferase-like protein 5 isoform X1 ... 60 2e-08 ref|NP_001236230.2| AdoMet-MTases superfamily protein [Glycine m... 60 2e-08 ref|XP_020998686.1| methyltransferase-like protein 5 isoform X2 ... 60 2e-08 ref|XP_016203733.1| methyltransferase-like protein 5 isoform X2 ... 60 3e-08 ref|XP_016203732.1| methyltransferase-like protein 5 isoform X1 ... 60 3e-08 ref|XP_015966540.1| methyltransferase-like protein 5 isoform X1 ... 60 3e-08 ref|XP_022157590.1| methyltransferase-like protein 5 [Momordica ... 59 5e-08 ref|XP_011620577.1| methyltransferase-like protein 5 isoform X2 ... 59 5e-08 ref|XP_006833407.1| methyltransferase-like protein 5 isoform X1 ... 59 6e-08 ref|XP_022022576.1| methyltransferase-like protein 5 [Helianthus... 59 8e-08 dbj|GAU12298.1| hypothetical protein TSUD_142070 [Trifolium subt... 58 1e-07 gb|EPS62276.1| hypothetical protein M569_12518, partial [Genlise... 54 2e-07 ref|XP_021865848.1| methyltransferase-like protein 5 [Spinacia o... 58 2e-07 gb|KNA08582.1| hypothetical protein SOVF_161330 [Spinacia oleracea] 58 2e-07 >ref|XP_020264152.1| methyltransferase-like protein 5 [Asparagus officinalis] Length = 211 Score = 63.9 bits (154), Expect = 8e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P+MYKFHRKKEVDIAVDLWRFVPG +K+S Sbjct: 180 YDVPQMYKFHRKKEVDIAVDLWRFVPGPAKKS 211 >gb|ONK69210.1| uncharacterized protein A4U43_C05F20490 [Asparagus officinalis] Length = 245 Score = 63.9 bits (154), Expect = 1e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P+MYKFHRKKEVDIAVDLWRFVPG +K+S Sbjct: 214 YDVPQMYKFHRKKEVDIAVDLWRFVPGPAKKS 245 >ref|XP_023748001.1| methyltransferase-like protein 5 [Lactuca sativa] Length = 94 Score = 60.1 bits (144), Expect = 3e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YDLP++YKFH+KKEVDIAVDLWRFVP +ES Sbjct: 61 YDLPKLYKFHKKKEVDIAVDLWRFVPKSKQES 92 >ref|XP_023739187.1| methyltransferase-like protein 5 isoform X2 [Lactuca sativa] ref|XP_023739193.1| methyltransferase-like protein 5 isoform X2 [Lactuca sativa] Length = 178 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YDLP++YKFH+KKEVDIAVDLWRFVP +ES Sbjct: 145 YDLPKLYKFHKKKEVDIAVDLWRFVPKSKQES 176 >gb|KRH76308.1| hypothetical protein GLYMA_01G145300 [Glycine max] Length = 205 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P+MYKFH+KKEVDIAVDLWRFVP S +S Sbjct: 171 YDVPKMYKFHKKKEVDIAVDLWRFVPAASHQS 202 >gb|KHN40126.1| Methyltransferase-like protein 5 [Glycine soja] Length = 206 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P+MYKFH+KKEVDIAVDLWRFVP S +S Sbjct: 172 YDVPKMYKFHKKKEVDIAVDLWRFVPAASHQS 203 >ref|XP_023739181.1| methyltransferase-like protein 5 isoform X1 [Lactuca sativa] gb|PLY96922.1| hypothetical protein LSAT_4X6541 [Lactuca sativa] Length = 213 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YDLP++YKFH+KKEVDIAVDLWRFVP +ES Sbjct: 180 YDLPKLYKFHKKKEVDIAVDLWRFVPKSKQES 211 >ref|NP_001236230.2| AdoMet-MTases superfamily protein [Glycine max] gb|KRH76307.1| hypothetical protein GLYMA_01G145300 [Glycine max] Length = 214 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P+MYKFH+KKEVDIAVDLWRFVP S +S Sbjct: 180 YDVPKMYKFHKKKEVDIAVDLWRFVPAASHQS 211 >ref|XP_020998686.1| methyltransferase-like protein 5 isoform X2 [Arachis duranensis] Length = 190 Score = 59.7 bits (143), Expect = 2e-08 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQ 293 YDLP++YKFH+KKEVDIAVDLWRFVPG+ Sbjct: 160 YDLPKLYKFHKKKEVDIAVDLWRFVPGK 187 >ref|XP_016203733.1| methyltransferase-like protein 5 isoform X2 [Arachis ipaensis] Length = 210 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQ 293 YDLP++YKFH+KKEVDIAVDLWRFVPG+ Sbjct: 180 YDLPKLYKFHKKKEVDIAVDLWRFVPGK 207 >ref|XP_016203732.1| methyltransferase-like protein 5 isoform X1 [Arachis ipaensis] Length = 210 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQ 293 YDLP++YKFH+KKEVDIAVDLWRFVPG+ Sbjct: 180 YDLPKLYKFHKKKEVDIAVDLWRFVPGK 207 >ref|XP_015966540.1| methyltransferase-like protein 5 isoform X1 [Arachis duranensis] Length = 210 Score = 59.7 bits (143), Expect = 3e-08 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQ 293 YDLP++YKFH+KKEVDIAVDLWRFVPG+ Sbjct: 180 YDLPKLYKFHKKKEVDIAVDLWRFVPGK 207 >ref|XP_022157590.1| methyltransferase-like protein 5 [Momordica charantia] Length = 218 Score = 59.3 bits (142), Expect = 5e-08 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES*VELR 266 YD+P++YKFH++KEVDIAVDLWRFVP ++E+ +E R Sbjct: 180 YDVPQLYKFHKRKEVDIAVDLWRFVPRSNRENTIENR 216 >ref|XP_011620577.1| methyltransferase-like protein 5 isoform X2 [Amborella trichopoda] Length = 193 Score = 58.9 bits (141), Expect = 5e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKE 284 +D+PRMYKFH+KKEVDIAVDLWRFVP S++ Sbjct: 161 FDVPRMYKFHKKKEVDIAVDLWRFVPDSSRK 191 >ref|XP_006833407.1| methyltransferase-like protein 5 isoform X1 [Amborella trichopoda] gb|ERM98685.1| hypothetical protein AMTR_s00109p00129220 [Amborella trichopoda] Length = 212 Score = 58.9 bits (141), Expect = 6e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKE 284 +D+PRMYKFH+KKEVDIAVDLWRFVP S++ Sbjct: 180 FDVPRMYKFHKKKEVDIAVDLWRFVPDSSRK 210 >ref|XP_022022576.1| methyltransferase-like protein 5 [Helianthus annuus] gb|OTF88171.1| putative S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Helianthus annuus] Length = 211 Score = 58.5 bits (140), Expect = 8e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YDLP++YKFH+KK+VDIAVDLWRFVP +ES Sbjct: 180 YDLPKLYKFHKKKDVDIAVDLWRFVPKAKQES 211 >dbj|GAU12298.1| hypothetical protein TSUD_142070 [Trifolium subterraneum] Length = 194 Score = 57.8 bits (138), Expect = 1e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSK 287 YD+P+MYKFH+KKEVDIAVDLWRFVP ++ Sbjct: 161 YDVPKMYKFHKKKEVDIAVDLWRFVPASNQ 190 >gb|EPS62276.1| hypothetical protein M569_12518, partial [Genlisea aurea] Length = 51 Score = 54.3 bits (129), Expect = 2e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQS 290 +D+P +YKFH+KKEVD+AVDLWRFVP +S Sbjct: 23 FDVPHLYKFHKKKEVDVAVDLWRFVPKRS 51 >ref|XP_021865848.1| methyltransferase-like protein 5 [Spinacia oleracea] Length = 213 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P++YKFH+KKEVDIAVDLWRFVP + ES Sbjct: 180 YDVPKLYKFHKKKEVDIAVDLWRFVPTPTVES 211 >gb|KNA08582.1| hypothetical protein SOVF_161330 [Spinacia oleracea] Length = 213 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 376 YDLPRMYKFHRKKEVDIAVDLWRFVPGQSKES 281 YD+P++YKFH+KKEVDIAVDLWRFVP + ES Sbjct: 180 YDVPKLYKFHKKKEVDIAVDLWRFVPTPTVES 211