BLASTX nr result
ID: Ophiopogon24_contig00019437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00019437 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK62585.1| uncharacterized protein A4U43_C07F5640 [Asparagus... 55 4e-06 ref|XP_020271550.1| probable WRKY transcription factor 70 [Aspar... 55 5e-06 >gb|ONK62585.1| uncharacterized protein A4U43_C07F5640 [Asparagus officinalis] Length = 201 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +3 Query: 3 DPPKYVVTYNKQHTCKKIDLLLNEEFVLEGGKFVIEPPPPISDPCQLSL 149 DPP Y+VTYNKQH+C K + + +EEF E + ++E PPI+DPCQLSL Sbjct: 158 DPPIYMVTYNKQHSC-KTNFIYSEEF--EQFELIVE--PPITDPCQLSL 201 >ref|XP_020271550.1| probable WRKY transcription factor 70 [Asparagus officinalis] Length = 219 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +3 Query: 3 DPPKYVVTYNKQHTCKKIDLLLNEEFVLEGGKFVIEPPPPISDPCQLSL 149 DPP Y+VTYNKQH+C K + + +EEF E + ++E PPI+DPCQLSL Sbjct: 176 DPPIYMVTYNKQHSC-KTNFIYSEEF--EQFELIVE--PPITDPCQLSL 219