BLASTX nr result
ID: Ophiopogon24_contig00019396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00019396 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275683.1| uncharacterized protein LOC109850156 [Aspara... 64 2e-09 >ref|XP_020275683.1| uncharacterized protein LOC109850156 [Asparagus officinalis] Length = 332 Score = 63.9 bits (154), Expect = 2e-09 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 1/85 (1%) Frame = -2 Query: 254 DVSNPQPSKVGEEAKAAED-PKPIDAYAKGKENCLDADAVKGSEIGTTEAEVSNNLDTDI 78 +VS PQP +V E+K AED + I+A + A KG E TT NN+D Sbjct: 79 EVSQPQPIEVKVESKEAEDRTETIEASISA------SSAAKGPETATTTQV--NNVDAAK 130 Query: 77 EKRRVEVEKKLGVLKQKKHHLVQIL 3 EKR++E+EKKL LKQKKHHLVQ+L Sbjct: 131 EKRKIELEKKLEHLKQKKHHLVQML 155