BLASTX nr result
ID: Ophiopogon24_contig00019152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00019152 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265716.1| two-component response regulator ORR22-like ... 78 4e-14 >ref|XP_020265716.1| two-component response regulator ORR22-like [Asparagus officinalis] gb|ONK70425.1| uncharacterized protein A4U43_C05F33600 [Asparagus officinalis] Length = 651 Score = 78.2 bits (191), Expect = 4e-14 Identities = 38/56 (67%), Positives = 39/56 (69%) Frame = -2 Query: 411 DGPSFEDMKLPXXXXXXXXXXXXLVGNPMIKPECDDFTFIDGDMGCNDLYSLGACM 244 D P FE MKLP LV N MIKPECDDFTFIDGD+GCNDLYSLGACM Sbjct: 596 DEPLFEGMKLPGGFNSGGFGLDDLVTNAMIKPECDDFTFIDGDIGCNDLYSLGACM 651