BLASTX nr result
ID: Ophiopogon24_contig00019136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00019136 (685 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254629.1| wee1-like protein kinase [Asparagus officina... 45 2e-06 >ref|XP_020254629.1| wee1-like protein kinase [Asparagus officinalis] Length = 477 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +1 Query: 85 SSSSAALTLHFVDVSLLSD---DPAFSHFQKLLD--ERXXXXXXXXXXNLCILNQDFF 243 SS + LTLHF VSLLS DPA S FQKLL+ + +LCIL+QDFF Sbjct: 32 SSPAGNLTLHFEHVSLLSSSVKDPASSRFQKLLEDPDAVPSNPAAEPEDLCILSQDFF 89 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 237 FLLENIACPKSPEKSVRTIRHRK 305 F E+ CPKSPEKSVR RHRK Sbjct: 105 FNKESSVCPKSPEKSVRNKRHRK 127