BLASTX nr result
ID: Ophiopogon24_contig00018824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018824 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247178.1| lysine-specific demethylase JMJ703 isoform X... 64 5e-09 >ref|XP_020247178.1| lysine-specific demethylase JMJ703 isoform X3 [Asparagus officinalis] Length = 1163 Score = 63.5 bits (153), Expect = 5e-09 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = -2 Query: 363 DHQLGSADQGALSGANAIVRCLLMKGNPEELQALHRLLSSNDPICMKELISLLDEEIERN 184 DHQLG+ + ++R LL K NPEEL+ LHRLLSS DP C K+L+ LL++EI++N Sbjct: 1111 DHQLGAD--------SVVIRGLLKKANPEELRTLHRLLSSGDPNCNKQLVGLLEDEIQKN 1162