BLASTX nr result
ID: Ophiopogon24_contig00018657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018657 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67301.1| uncharacterized protein A4U43_C06F18730 [Asparagu... 55 1e-05 >gb|ONK67301.1| uncharacterized protein A4U43_C06F18730 [Asparagus officinalis] Length = 258 Score = 54.7 bits (130), Expect = 1e-05 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -1 Query: 450 CFKCGQAGHWARDCTAQDSGVGYGDRKASCSVRTPFASKYK 328 CFKCGQ+GH ARDCT Q+ RKAS S +TPFA++Y+ Sbjct: 184 CFKCGQSGHRARDCTGQEISAVAVKRKASRSFQTPFANRYR 224