BLASTX nr result
ID: Ophiopogon24_contig00018616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018616 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013443671.1| hypothetical protein MTR_0002s0260 [Medicago... 45 7e-08 >ref|XP_013443671.1| hypothetical protein MTR_0002s0260 [Medicago truncatula] gb|KEH17696.1| hypothetical protein MTR_0002s0260 [Medicago truncatula] Length = 74 Score = 44.7 bits (104), Expect(2) = 7e-08 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = -3 Query: 348 NRPIYPPEE--VWFQALIRT-GVHDDNVPLIIHISG 250 NRPIYPPEE VWFQ I+T GV NVP +IHI G Sbjct: 6 NRPIYPPEEKFVWFQTPIQTGGVRHANVPWMIHIFG 41 Score = 39.7 bits (91), Expect(2) = 7e-08 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -2 Query: 241 GAGEHIEPSMWLRALTIQIQ-HNYQERA 161 GA EHIE SMWLRALT Q Q NYQ RA Sbjct: 43 GADEHIELSMWLRALTAQAQRRNYQGRA 70