BLASTX nr result
ID: Ophiopogon24_contig00018604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018604 (651 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344089.1| PREDICTED: putative B3 domain-containing pro... 57 4e-06 >ref|XP_006344089.1| PREDICTED: putative B3 domain-containing protein At5g58280 [Solanum tuberosum] Length = 290 Score = 57.0 bits (136), Expect = 4e-06 Identities = 34/82 (41%), Positives = 51/82 (62%) Frame = -2 Query: 650 DVLVFELSEPTRFKVYVIKAHQESSTEDFSGNKSAQEDGSTAHEHGKTAQEDGSTAQEVD 471 D LVFEL EPT+FKVY+++A Q SS D S SA++ S A E K+ ++ EV Sbjct: 212 DALVFELVEPTKFKVYIVRASQCSSEVDKS---SAEKGESEAEETPKSERKKRKNKSEVP 268 Query: 470 KIAQEETDGIIMRADTKKSEKR 405 IA+EE +++ + T++S +R Sbjct: 269 TIAKEEV-SVVVASATRRSSRR 289