BLASTX nr result
ID: Ophiopogon24_contig00018345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018345 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55675.1| uncharacterized protein A4U43_UnF280 [Asparagus o... 46 5e-06 ref|XP_020249605.1| uncharacterized protein LOC109827052 [Aspara... 46 5e-06 >gb|ONK55675.1| uncharacterized protein A4U43_UnF280 [Asparagus officinalis] Length = 595 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 97 VSDEKIRKATDFFAKEMGWGPSLLSKRPELLKYRFEREL 213 +S++KIRKA DF+ KE+ WGPS LS P LL E+ + Sbjct: 493 LSEKKIRKAMDFYVKELKWGPSFLSVHPVLLNLSLEKRV 531 Score = 31.6 bits (70), Expect(2) = 5e-06 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +2 Query: 26 VGQGLGWSREEIMSAFTREP 85 V + LGWS++E+MSAF R+P Sbjct: 469 VYKSLGWSQKEVMSAFVRQP 488 >ref|XP_020249605.1| uncharacterized protein LOC109827052 [Asparagus officinalis] Length = 385 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 97 VSDEKIRKATDFFAKEMGWGPSLLSKRPELLKYRFEREL 213 +S++KIRKA DF+ KE+ WGPS LS P LL E+ + Sbjct: 283 LSEKKIRKAMDFYVKELKWGPSFLSVHPVLLNLSLEKRV 321 Score = 31.6 bits (70), Expect(2) = 5e-06 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +2 Query: 26 VGQGLGWSREEIMSAFTREP 85 V + LGWS++E+MSAF R+P Sbjct: 259 VYKSLGWSQKEVMSAFVRQP 278