BLASTX nr result
ID: Ophiopogon24_contig00018027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00018027 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250187.1| uncharacterized protein LOC109827589 [Aspara... 82 3e-15 gb|ONK80853.1| uncharacterized protein A4U43_C01F22500 [Asparagu... 82 3e-15 >ref|XP_020250187.1| uncharacterized protein LOC109827589 [Asparagus officinalis] Length = 792 Score = 82.0 bits (201), Expect = 3e-15 Identities = 49/109 (44%), Positives = 61/109 (55%), Gaps = 1/109 (0%) Frame = -3 Query: 367 YPSNESSSHA-LPKQAQYPHLESFHMISPRIAIDEQESRYPLHYPSVPSPPENKIEPQYE 191 +P +ES+ LPKQ QYP E +HM R A DEQ S +P YP+ P ENK E + E Sbjct: 185 HPQSESNHMMPLPKQPQYPRSEGYHMT--RTASDEQGSHHPPPYPNYGPPLENKFELRNE 242 Query: 190 QRTHFVSKHLVSEEIWRPIEPYVNSMPYESNGYKMDSVMEGRVHTSQAY 44 Q THF K PYV+S +ESN Y+MDS + GRV+ S Y Sbjct: 243 QITHFAPK------------PYVSSASHESNDYRMDSTLPGRVYNSLHY 279 >gb|ONK80853.1| uncharacterized protein A4U43_C01F22500 [Asparagus officinalis] Length = 868 Score = 82.0 bits (201), Expect = 3e-15 Identities = 49/109 (44%), Positives = 61/109 (55%), Gaps = 1/109 (0%) Frame = -3 Query: 367 YPSNESSSHA-LPKQAQYPHLESFHMISPRIAIDEQESRYPLHYPSVPSPPENKIEPQYE 191 +P +ES+ LPKQ QYP E +HM R A DEQ S +P YP+ P ENK E + E Sbjct: 267 HPQSESNHMMPLPKQPQYPRSEGYHMT--RTASDEQGSHHPPPYPNYGPPLENKFELRNE 324 Query: 190 QRTHFVSKHLVSEEIWRPIEPYVNSMPYESNGYKMDSVMEGRVHTSQAY 44 Q THF K PYV+S +ESN Y+MDS + GRV+ S Y Sbjct: 325 QITHFAPK------------PYVSSASHESNDYRMDSTLPGRVYNSLHY 361