BLASTX nr result
ID: Ophiopogon24_contig00017729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00017729 (1101 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZT32050.1| hypothetical protein SISSUDRAFT_958931, partial [... 57 4e-07 gb|KZS86363.1| hypothetical protein SISNIDRAFT_392964, partial [... 58 6e-07 gb|KZS87109.1| hypothetical protein SISNIDRAFT_420068, partial [... 58 1e-06 gb|PKY35283.1| hypothetical protein RhiirB3_298767, partial [Rhi... 55 2e-06 gb|KIJ35400.1| hypothetical protein M422DRAFT_262363 [Sphaerobol... 57 4e-06 >gb|KZT32050.1| hypothetical protein SISSUDRAFT_958931, partial [Sistotremastrum suecicum HHB10207 ss-3] Length = 73 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 118 RTQLPIILCWAITIHKSQGLTLDRAVVDIGDRE-SLGLTF 2 RTQLP+I WAITIHKSQGLTL R V+D+G+ + +LGL+F Sbjct: 2 RTQLPLITAWAITIHKSQGLTLVRVVIDLGENDFALGLSF 41 >gb|KZS86363.1| hypothetical protein SISNIDRAFT_392964, partial [Sistotremastrum niveocremeum HHB9708] Length = 101 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 124 IQRTQLPIILCWAITIHKSQGLTLDRAVVDIGDRE-SLGLTF 2 + RTQLP+I WAITIHKSQGLTL R V+D+G+ + +LGL+F Sbjct: 18 LTRTQLPLITAWAITIHKSQGLTLVRVVIDLGENDFALGLSF 59 >gb|KZS87109.1| hypothetical protein SISNIDRAFT_420068, partial [Sistotremastrum niveocremeum HHB9708] Length = 124 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 124 IQRTQLPIILCWAITIHKSQGLTLDRAVVDIGDRE-SLGLTF 2 + RTQLP+I WAITIHKSQGLTL R V+D+G+ + +LGL+F Sbjct: 18 LTRTQLPLITAWAITIHKSQGLTLVRVVIDLGENDFALGLSF 59 >gb|PKY35283.1| hypothetical protein RhiirB3_298767, partial [Rhizophagus irregularis] Length = 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -3 Query: 118 RTQLPIILCWAITIHKSQGLTLDRAVVDIGDRE-SLGLTF 2 RTQLPI L W+IT HKSQGLTLD+ +DIG +E + GLTF Sbjct: 1 RTQLPICLAWSITAHKSQGLTLDKVNIDIGVKEFAAGLTF 40 >gb|KIJ35400.1| hypothetical protein M422DRAFT_262363 [Sphaerobolus stellatus SS14] Length = 183 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/42 (64%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 124 IQRTQLPIILCWAITIHKSQGLTLDRAVVDIGDRE-SLGLTF 2 + R+QLP+ L WAITIHKSQGLTL+R V+++G +E SLGL+F Sbjct: 81 LARSQLPLTLAWAITIHKSQGLTLERVVIELGLKEFSLGLSF 122