BLASTX nr result
ID: Ophiopogon24_contig00017609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00017609 (790 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019704988.1| PREDICTED: glutamine--tRNA ligase-like isofo... 60 1e-06 ref|XP_010915141.1| PREDICTED: glutamine--tRNA ligase-like isofo... 60 1e-06 gb|AQK90883.1| Glutaminyl-tRNA synthetase, partial [Zea mays] 59 2e-06 gb|ONM29180.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] >gi... 59 2e-06 gb|AQK90875.1| Glutaminyl-tRNA synthetase, partial [Zea mays] 59 2e-06 gb|ONM29177.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] 59 2e-06 gb|ONM29175.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea ... 59 2e-06 gb|ONM29179.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea ... 59 2e-06 gb|ONM29176.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] 59 3e-06 gb|AQK90874.1| Glutaminyl-tRNA synthetase [Zea mays] >gi|1142832... 59 3e-06 gb|ONM29181.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea ... 59 3e-06 gb|ONM29186.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea ... 59 3e-06 gb|AQK90877.1| Glutaminyl-tRNA synthetase, partial [Zea mays] 59 3e-06 gb|ONM29183.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] 59 3e-06 gb|AQK90884.1| Glutaminyl-tRNA synthetase [Zea mays] 59 3e-06 gb|OEL25456.1| Glutamine--tRNA ligase [Dichanthelium oligosanthes] 59 3e-06 gb|ONM29187.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] 59 3e-06 gb|PAN32641.1| hypothetical protein PAHAL_E04255 [Panicum hallii] 59 3e-06 ref|XP_008672778.2| uncharacterized protein LOC100280365 isoform... 59 3e-06 ref|NP_001152305.1| glutaminyl-tRNA synthetase [Zea mays] >gi|19... 59 3e-06 >ref|XP_019704988.1| PREDICTED: glutamine--tRNA ligase-like isoform X2 [Elaeis guineensis] Length = 646 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNSMIRVD LEYHIREELNKTAPRTMVVL Sbjct: 556 SDNSMIRVDRLEYHIREELNKTAPRTMVVL 585 >ref|XP_010915141.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Elaeis guineensis] Length = 795 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNSMIRVD LEYHIREELNKTAPRTMVVL Sbjct: 556 SDNSMIRVDRLEYHIREELNKTAPRTMVVL 585 >gb|AQK90883.1| Glutaminyl-tRNA synthetase, partial [Zea mays] Length = 427 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 225 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 254 >gb|ONM29180.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] gb|ONM29185.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 464 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 225 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 254 >gb|AQK90875.1| Glutaminyl-tRNA synthetase, partial [Zea mays] Length = 487 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 285 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 314 >gb|ONM29177.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 505 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 266 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 295 >gb|ONM29175.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea mays] Length = 594 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 402 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 431 >gb|ONM29179.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea mays] gb|ONM29182.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea mays] Length = 608 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 416 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 445 >gb|ONM29176.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 641 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 402 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 431 >gb|AQK90874.1| Glutaminyl-tRNA synthetase [Zea mays] gb|AQK90876.1| Glutaminyl-tRNA synthetase [Zea mays] gb|AQK90878.1| Glutaminyl-tRNA synthetase [Zea mays] gb|AQK90879.1| Glutaminyl-tRNA synthetase [Zea mays] Length = 655 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 416 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 445 >gb|ONM29181.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea mays] Length = 722 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 530 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 559 >gb|ONM29186.1| Glutamine--tRNA ligase cytoplasmic, partial [Zea mays] Length = 749 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586 >gb|AQK90877.1| Glutaminyl-tRNA synthetase, partial [Zea mays] Length = 759 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586 >gb|ONM29183.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 764 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586 >gb|AQK90884.1| Glutaminyl-tRNA synthetase [Zea mays] Length = 769 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 530 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 559 >gb|OEL25456.1| Glutamine--tRNA ligase [Dichanthelium oligosanthes] Length = 770 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 537 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 566 >gb|ONM29187.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 780 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 573 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 602 >gb|PAN32641.1| hypothetical protein PAHAL_E04255 [Panicum hallii] Length = 796 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586 >ref|XP_008672778.2| uncharacterized protein LOC100280365 isoform X1 [Zea mays] gb|ONM29178.1| Glutamine--tRNA ligase cytoplasmic [Zea mays] Length = 796 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586 >ref|NP_001152305.1| glutaminyl-tRNA synthetase [Zea mays] gb|ACG46917.1| glutaminyl-tRNA synthetase [Zea mays] gb|AQK90880.1| Glutaminyl-tRNA synthetase [Zea mays] Length = 796 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 700 SDNSMIRVDHLEYHIREELNKTAPRTMVVL 789 SDNS+IRVD LEYHIREELNKTAPRTMVVL Sbjct: 557 SDNSLIRVDRLEYHIREELNKTAPRTMVVL 586