BLASTX nr result
ID: Ophiopogon24_contig00017219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00017219 (637 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261198.1| LOW QUALITY PROTEIN: eukaryotic translation ... 81 5e-14 gb|ONK72112.1| uncharacterized protein A4U43_C04F15830 [Asparagu... 81 5e-14 ref|XP_008809293.1| PREDICTED: eukaryotic translation initiation... 77 1e-12 ref|XP_010925041.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic t... 77 1e-12 gb|OAY78585.1| Eukaryotic translation initiation factor 5B [Anan... 76 2e-12 ref|XP_020110215.1| eukaryotic translation initiation factor 5B-... 76 2e-12 ref|XP_010937547.1| PREDICTED: eukaryotic translation initiation... 75 4e-12 ref|XP_020701235.1| eukaryotic translation initiation factor 5B-... 75 4e-12 ref|XP_021660503.1| eukaryotic translation initiation factor 5B ... 73 2e-11 dbj|BAD94491.1| translation initiation factor IF-2 like protein ... 70 2e-11 gb|AAN32916.1| translation initiation factor [Pisum sativum] 73 3e-11 ref|XP_008808243.1| PREDICTED: eukaryotic translation initiation... 73 3e-11 ref|XP_009383092.1| PREDICTED: eukaryotic translation initiation... 73 3e-11 ref|XP_020599945.1| eukaryotic translation initiation factor 5B-... 73 3e-11 gb|PKI57443.1| hypothetical protein CRG98_022094 [Punica granatum] 70 3e-11 dbj|GAU13353.1| hypothetical protein TSUD_43070 [Trifolium subte... 70 3e-11 ref|XP_021300702.1| eukaryotic translation initiation factor 5B-... 69 3e-11 gb|POF00410.1| eukaryotic translation initiation factor 5b [Quer... 71 4e-11 ref|XP_010270316.1| PREDICTED: eukaryotic translation initiation... 72 4e-11 ref|XP_009400529.1| PREDICTED: eukaryotic translation initiation... 72 6e-11 >ref|XP_020261198.1| LOW QUALITY PROTEIN: eukaryotic translation initiation factor 5B-like [Asparagus officinalis] Length = 1225 Score = 80.9 bits (198), Expect = 5e-14 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 2 GDELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 GDELVSHITRRSIDVLKADYRDDLS EEWKLVVKLKQIFKI Sbjct: 1184 GDELVSHITRRSIDVLKADYRDDLSIEEWKLVVKLKQIFKI 1224 >gb|ONK72112.1| uncharacterized protein A4U43_C04F15830 [Asparagus officinalis] Length = 1260 Score = 80.9 bits (198), Expect = 5e-14 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 2 GDELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 GDELVSHITRRSIDVLKADYRDDLS EEWKLVVKLKQIFKI Sbjct: 1219 GDELVSHITRRSIDVLKADYRDDLSIEEWKLVVKLKQIFKI 1259 >ref|XP_008809293.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Phoenix dactylifera] Length = 1239 Score = 76.6 bits (187), Expect = 1e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LKA+YRDDLS EEWKLVV+LKQIFKIP Sbjct: 1199 DELVSHISRRSIDILKANYRDDLSLEEWKLVVRLKQIFKIP 1239 >ref|XP_010925041.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 5B-like [Elaeis guineensis] Length = 1242 Score = 76.6 bits (187), Expect = 1e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LKA+YRDDLS EEWKLVV+LKQIFKIP Sbjct: 1202 DELVSHISRRSIDILKANYRDDLSLEEWKLVVRLKQIFKIP 1242 >gb|OAY78585.1| Eukaryotic translation initiation factor 5B [Ananas comosus] Length = 1084 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LKA+YRDDLS EEWKLVV+LKQIFKIP Sbjct: 1044 DELVSHISRRSIDILKANYRDDLSIEEWKLVVRLKQIFKIP 1084 >ref|XP_020110215.1| eukaryotic translation initiation factor 5B-like [Ananas comosus] Length = 1237 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LKA+YRDDLS EEWKLVV+LKQIFKIP Sbjct: 1197 DELVSHISRRSIDILKANYRDDLSIEEWKLVVRLKQIFKIP 1237 >ref|XP_010937547.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Elaeis guineensis] Length = 1223 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LKA+YRDDLS EEW+LVV+LKQIFKIP Sbjct: 1183 DELVSHISRRSIDILKANYRDDLSLEEWRLVVRLKQIFKIP 1223 >ref|XP_020701235.1| eukaryotic translation initiation factor 5B-like [Dendrobium catenatum] gb|PKU87339.1| Translation initiation factor IF-2, chloroplastic [Dendrobium catenatum] Length = 1296 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSIDVLKA+YRDDLS EEW+LVVKLK +FKIP Sbjct: 1256 DELVSHISRRSIDVLKANYRDDLSNEEWRLVVKLKNVFKIP 1296 >ref|XP_021660503.1| eukaryotic translation initiation factor 5B [Hevea brasiliensis] Length = 1371 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 D L+SH+TRRSIDVLK +YRDDLS EEWKLVVKLK IFKIP Sbjct: 1331 DLLISHVTRRSIDVLKTNYRDDLSMEEWKLVVKLKNIFKIP 1371 >dbj|BAD94491.1| translation initiation factor IF-2 like protein [Arabidopsis thaliana] Length = 202 Score = 70.5 bits (171), Expect = 2e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHI+RRSID+LK++YRD+LS EEWKLVVKLK IFKI Sbjct: 162 DELVSHISRRSIDILKSNYRDELSLEEWKLVVKLKNIFKI 201 >gb|AAN32916.1| translation initiation factor [Pisum sativum] Length = 861 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHI+RRSIDVLK+DYRD+LS EEWKLVVKLK +FKI Sbjct: 821 DELVSHISRRSIDVLKSDYRDELSNEEWKLVVKLKSLFKI 860 >ref|XP_008808243.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Phoenix dactylifera] ref|XP_008808251.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Phoenix dactylifera] Length = 1233 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID LKA+YRD+LS EEW+LVV+LKQIFKIP Sbjct: 1193 DELVSHISRRSIDTLKANYRDELSLEEWRLVVRLKQIFKIP 1233 >ref|XP_009383092.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Musa acuminata subsp. malaccensis] Length = 1311 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LK +YRDDLS EEW+LVV+LK IFKIP Sbjct: 1271 DELVSHISRRSIDILKTNYRDDLSMEEWRLVVRLKSIFKIP 1311 >ref|XP_020599945.1| eukaryotic translation initiation factor 5B-like [Phalaenopsis equestris] Length = 1366 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSIDVLK +YRDDLS +EW+LVVKLK +FKIP Sbjct: 1326 DELVSHISRRSIDVLKTNYRDDLSNDEWRLVVKLKNVFKIP 1366 >gb|PKI57443.1| hypothetical protein CRG98_022094 [Punica granatum] Length = 220 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHI+RRSID+LK +YRDDLS EEWKLVVKLK +FKI Sbjct: 180 DELVSHISRRSIDILKTNYRDDLSIEEWKLVVKLKSLFKI 219 >dbj|GAU13353.1| hypothetical protein TSUD_43070 [Trifolium subterraneum] Length = 220 Score = 70.5 bits (171), Expect = 3e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHI+RRSID+LK +YRDDLS EEWKLVVKLK +F+I Sbjct: 180 DELVSHISRRSIDILKTNYRDDLSMEEWKLVVKLKSLFRI 219 >ref|XP_021300702.1| eukaryotic translation initiation factor 5B-like, partial [Herrania umbratica] Length = 135 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSIDVLKA+YRDDL+ EEW+LV +LK +FKIP Sbjct: 95 DELVSHISRRSIDVLKANYRDDLTLEEWRLVQRLKILFKIP 135 >gb|POF00410.1| eukaryotic translation initiation factor 5b [Quercus suber] Length = 254 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHITRRSIDVLKA+YR++L+ EEWKLVVKLK +FKI Sbjct: 214 DELVSHITRRSIDVLKANYREELNMEEWKLVVKLKNLFKI 253 >ref|XP_010270316.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Nelumbo nucifera] ref|XP_010270325.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Nelumbo nucifera] Length = 1443 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKI 124 DELVSHITRRSIDVLKA+YRDDLS EEW+LVVKLK IF+I Sbjct: 1403 DELVSHITRRSIDVLKANYRDDLSIEEWRLVVKLKNIFRI 1442 >ref|XP_009400529.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Musa acuminata subsp. malaccensis] Length = 1239 Score = 72.0 bits (175), Expect = 6e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +2 Query: 5 DELVSHITRRSIDVLKADYRDDLSQEEWKLVVKLKQIFKIP 127 DELVSHI+RRSID+LK++YRDDLS EEW+LVV+LK IFKIP Sbjct: 1199 DELVSHISRRSIDILKSNYRDDLSIEEWRLVVRLKSIFKIP 1239