BLASTX nr result
ID: Ophiopogon24_contig00017072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00017072 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60028.1| uncharacterized protein A4U43_C08F13450, partial ... 55 2e-06 ref|XP_020244716.1| cytochrome P450 81D11-like [Asparagus offici... 55 3e-06 >gb|ONK60028.1| uncharacterized protein A4U43_C08F13450, partial [Asparagus officinalis] Length = 213 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 427 LIDMEETGGLTLHKVNPLQAMYRPCQAMVGVLSQI 323 LIDMEETGGL LHK +PL+ MYRP Q+MV +LSQI Sbjct: 176 LIDMEETGGLILHKADPLRVMYRPRQSMVDLLSQI 210 >ref|XP_020244716.1| cytochrome P450 81D11-like [Asparagus officinalis] Length = 324 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 427 LIDMEETGGLTLHKVNPLQAMYRPCQAMVGVLSQI 323 LIDMEETGGL LHK +PL+ MYRP Q+MV +LSQI Sbjct: 287 LIDMEETGGLILHKADPLRVMYRPRQSMVDLLSQI 321