BLASTX nr result
ID: Ophiopogon24_contig00017022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00017022 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79204.1| uncharacterized protein A4U43_C01F3980 [Asparagus... 55 9e-06 >gb|ONK79204.1| uncharacterized protein A4U43_C01F3980 [Asparagus officinalis] Length = 235 Score = 55.1 bits (131), Expect = 9e-06 Identities = 46/110 (41%), Positives = 58/110 (52%), Gaps = 17/110 (15%) Frame = -3 Query: 574 AGVFLWR---ICLLVL--PTTICDLFMLLGCLVLSLICHCF---ATVLYPW--PTNFIGR 425 A VFLWR I VL T I LF LL +LSL+CHC VL+ W T FI + Sbjct: 77 ADVFLWRNKKISASVLGGATAIWVLFELLEYHLLSLVCHCLILSLAVLFLWSNATTFINK 136 Query: 424 TAPRISEL-------IKKLLAVLGGINRGLAEINRGIASGSRLLKFIVAL 296 + P I E+ + L++ INRGLA + R IASG L KFI+ + Sbjct: 137 SPPHIPEVSIPEDLTVNIALSLRYEINRGLA-VLRSIASGKDLKKFIIVI 185