BLASTX nr result
ID: Ophiopogon24_contig00016999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016999 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273412.1| sugar transporter ERD6-like 5 [Asparagus off... 59 3e-07 emb|CDP17980.1| unnamed protein product [Coffea canephora] 57 7e-07 ref|XP_021622936.1| sugar transporter ERD6-like 5 [Manihot escul... 55 3e-06 >ref|XP_020273412.1| sugar transporter ERD6-like 5 [Asparagus officinalis] Length = 464 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 92 VGFSSPTQDGIIHDLDLSLAEYSVFGSILT 3 VGFSSP+QDGI+HDLDLSL+EYSVFGSILT Sbjct: 45 VGFSSPSQDGIMHDLDLSLSEYSVFGSILT 74 >emb|CDP17980.1| unnamed protein product [Coffea canephora] Length = 462 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 104 YFFQVGFSSPTQDGIIHDLDLSLAEYSVFGSILT 3 Y F VG+SSP + GI+HDLDLS+AEYSVFGSILT Sbjct: 39 YGFAVGYSSPAESGIMHDLDLSIAEYSVFGSILT 72 >ref|XP_021622936.1| sugar transporter ERD6-like 5 [Manihot esculenta] gb|OAY42217.1| hypothetical protein MANES_09G162500 [Manihot esculenta] Length = 485 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 92 VGFSSPTQDGIIHDLDLSLAEYSVFGSILT 3 VG+SSPTQ GI HDLDLSLAEYSVFGSI+T Sbjct: 64 VGYSSPTQAGITHDLDLSLAEYSVFGSIIT 93