BLASTX nr result
ID: Ophiopogon24_contig00016852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016852 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269799.1| sprT-like domain-containing protein Spartan ... 63 8e-09 ref|XP_020269798.1| sprT-like domain-containing protein Spartan ... 63 9e-09 >ref|XP_020269799.1| sprT-like domain-containing protein Spartan isoform X4 [Asparagus officinalis] gb|ONK66177.1| uncharacterized protein A4U43_C06F4920 [Asparagus officinalis] Length = 391 Score = 63.2 bits (152), Expect = 8e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 314 MELGAKSVEVSDPNPDIYELFNHYNSLYFDNALASCIVYWT 436 ME G K E S+ PDI+ELF HYNSLYFD+AL++CIVYW+ Sbjct: 1 MESGEKLEEPSETRPDIFELFGHYNSLYFDDALSACIVYWS 41 >ref|XP_020269798.1| sprT-like domain-containing protein Spartan isoform X3 [Asparagus officinalis] Length = 394 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 314 MELGAKSVEVSDPNPDIYELFNHYNSLYFDNALASCIVYWT 436 ME G K E S+ PDI+ELF HYNSLYFD+AL++CIVYW+ Sbjct: 1 MESGEKLEEPSETRPDIFELFGHYNSLYFDDALSACIVYWS 41