BLASTX nr result
ID: Ophiopogon24_contig00016851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016851 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020693584.1| ATP synthase subunit epsilon, mitochondrial-... 86 2e-19 ref|XP_008789701.1| PREDICTED: ATP synthase subunit epsilon, mit... 86 2e-19 gb|PKA52811.1| ATP synthase subunit epsilon, mitochondrial [Apos... 86 3e-19 gb|PKU77221.1| ATP synthase subunit epsilon, mitochondrial [Dend... 84 6e-19 ref|XP_010928624.1| PREDICTED: ATP synthase subunit epsilon, mit... 84 1e-18 ref|XP_010913615.1| PREDICTED: ATP synthase subunit epsilon, mit... 84 1e-18 ref|XP_020580830.1| ATP synthase subunit epsilon, mitochondrial ... 83 2e-18 ref|XP_020696665.1| ATP synthase subunit epsilon, mitochondrial-... 84 2e-18 gb|OAY74368.1| ATP synthase subunit epsilon, mitochondrial, part... 83 2e-18 ref|XP_020109976.1| ATP synthase subunit epsilon, mitochondrial-... 83 3e-18 gb|ONK70518.1| uncharacterized protein A4U43_C05F34530 [Asparagu... 82 3e-18 ref|XP_020103450.1| ATP synthase subunit epsilon, mitochondrial-... 82 4e-18 gb|AAM28278.1| ATP synthase epsilon subunit [Ananas comosus] 82 4e-18 gb|OAY82393.1| ATP synthase subunit epsilon, mitochondrial [Anan... 82 4e-18 gb|EOX92440.1| ATP synthase epsilon chain, mitochondrial isoform... 82 5e-18 ref|XP_021275198.1| ATP synthase subunit epsilon, mitochondrial ... 82 6e-18 ref|XP_007048281.2| PREDICTED: ATP synthase subunit epsilon, mit... 82 6e-18 ref|XP_009384910.1| PREDICTED: ATP synthase subunit epsilon, mit... 82 6e-18 ref|XP_018684048.1| PREDICTED: ATP synthase subunit epsilon, mit... 83 7e-18 ref|XP_009400329.1| PREDICTED: ATP synthase subunit epsilon, mit... 83 8e-18 >ref|XP_020693584.1| ATP synthase subunit epsilon, mitochondrial-like [Dendrobium catenatum] Length = 75 Score = 85.9 bits (211), Expect = 2e-19 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAA+REKVH Sbjct: 13 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAASREKVH 52 >ref|XP_008789701.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Phoenix dactylifera] Length = 75 Score = 85.9 bits (211), Expect = 2e-19 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAA+REKVH Sbjct: 13 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAASREKVH 52 >gb|PKA52811.1| ATP synthase subunit epsilon, mitochondrial [Apostasia shenzhenica] Length = 86 Score = 85.5 bits (210), Expect = 3e-19 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYI+YSNICASLVRSCLKEPYKSEAAAREKVH Sbjct: 11 PFWRAAGMTYISYSNICASLVRSCLKEPYKSEAAAREKVH 50 >gb|PKU77221.1| ATP synthase subunit epsilon, mitochondrial [Dendrobium catenatum] Length = 75 Score = 84.3 bits (207), Expect = 6e-19 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVR CLKEPYKSEAA+REKVH Sbjct: 13 PFWRAAGMTYITYSNICASLVRGCLKEPYKSEAASREKVH 52 >ref|XP_010928624.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Elaeis guineensis] Length = 75 Score = 83.6 bits (205), Expect = 1e-18 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSN+CASLVR CLKEPYKSEAA REKVH Sbjct: 13 PFWRAAGMTYITYSNVCASLVRGCLKEPYKSEAATREKVH 52 >ref|XP_010913615.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Elaeis guineensis] Length = 107 Score = 84.3 bits (207), Expect = 1e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPYK+EAA REKVH Sbjct: 45 PFWRAAGMTYITYSNICASLVRSCLKEPYKTEAATREKVH 84 >ref|XP_020580830.1| ATP synthase subunit epsilon, mitochondrial [Phalaenopsis equestris] Length = 70 Score = 83.2 bits (204), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVR CLKEPYKS+AA+REKVH Sbjct: 8 PFWRAAGMTYITYSNICASLVRGCLKEPYKSDAASREKVH 47 >ref|XP_020696665.1| ATP synthase subunit epsilon, mitochondrial-like [Dendrobium catenatum] gb|PKU60734.1| ATP synthase subunit epsilon, mitochondrial [Dendrobium catenatum] Length = 121 Score = 84.3 bits (207), Expect = 2e-18 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVR CLKEPYKSEAA+REKVH Sbjct: 8 PFWRAAGMTYITYSNICASLVRGCLKEPYKSEAASREKVH 47 >gb|OAY74368.1| ATP synthase subunit epsilon, mitochondrial, partial [Ananas comosus] Length = 70 Score = 82.8 bits (203), Expect = 2e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEP+KSEA +REKVH Sbjct: 8 PFWRAAGMTYITYSNICASLVRSCLKEPFKSEATSREKVH 47 >ref|XP_020109976.1| ATP synthase subunit epsilon, mitochondrial-like [Ananas comosus] Length = 78 Score = 82.8 bits (203), Expect = 3e-18 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEP+KSEA +REKVH Sbjct: 16 PFWRAAGMTYITYSNICASLVRSCLKEPFKSEATSREKVH 55 >gb|ONK70518.1| uncharacterized protein A4U43_C05F34530 [Asparagus officinalis] Length = 69 Score = 82.4 bits (202), Expect = 3e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPY++E+A+REKVH Sbjct: 11 PFWRAAGMTYITYSNICASLVRSCLKEPYRAESASREKVH 50 >ref|XP_020103450.1| ATP synthase subunit epsilon, mitochondrial-like [Ananas comosus] ref|XP_020103451.1| ATP synthase subunit epsilon, mitochondrial-like [Ananas comosus] Length = 77 Score = 82.4 bits (202), Expect = 4e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASL+RSCLKEPYK++AA+REKVH Sbjct: 15 PFWRAAGMTYITYSNICASLLRSCLKEPYKADAASREKVH 54 >gb|AAM28278.1| ATP synthase epsilon subunit [Ananas comosus] Length = 77 Score = 82.4 bits (202), Expect = 4e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASL+RSCLKEPYK++AA+REKVH Sbjct: 15 PFWRAAGMTYITYSNICASLLRSCLKEPYKADAASREKVH 54 >gb|OAY82393.1| ATP synthase subunit epsilon, mitochondrial [Ananas comosus] Length = 79 Score = 82.4 bits (202), Expect = 4e-18 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASL+RSCLKEPYK++AA+REKVH Sbjct: 15 PFWRAAGMTYITYSNICASLLRSCLKEPYKADAASREKVH 54 >gb|EOX92440.1| ATP synthase epsilon chain, mitochondrial isoform 2 [Theobroma cacao] Length = 64 Score = 81.6 bits (200), Expect = 5e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICA+LVR+CLKEPYK+EA AREKVH Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPYKTEALAREKVH 47 >ref|XP_021275198.1| ATP synthase subunit epsilon, mitochondrial [Herrania umbratica] Length = 70 Score = 81.6 bits (200), Expect = 6e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICA+LVR+CLKEPYK+EA AREKVH Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPYKTEALAREKVH 47 >ref|XP_007048281.2| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Theobroma cacao] gb|EOX92439.1| ATP synthase epsilon chain, mitochondrial isoform 1 [Theobroma cacao] Length = 70 Score = 81.6 bits (200), Expect = 6e-18 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICA+LVR+CLKEPYK+EA AREKVH Sbjct: 8 PFWRAAGMTYITYSNICANLVRNCLKEPYKTEALAREKVH 47 >ref|XP_009384910.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 81.6 bits (200), Expect = 6e-18 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVR CLKEPY+SEA +REKVH Sbjct: 9 PFWRAAGMTYITYSNICASLVRGCLKEPYRSEAVSREKVH 48 >ref|XP_018684048.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like isoform X4 [Musa acuminata subsp. malaccensis] Length = 113 Score = 82.8 bits (203), Expect = 7e-18 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPYKSE + REKVH Sbjct: 10 PFWRAAGMTYITYSNICASLVRSCLKEPYKSETSGREKVH 49 >ref|XP_009400329.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like isoform X3 [Musa acuminata subsp. malaccensis] ref|XP_009400337.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 119 Score = 82.8 bits (203), Expect = 8e-18 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 121 PFWRAAGMTYITYSNICASLVRSCLKEPYKSEAAAREKVH 2 PFWRAAGMTYITYSNICASLVRSCLKEPYKSE + REKVH Sbjct: 10 PFWRAAGMTYITYSNICASLVRSCLKEPYKSETSGREKVH 49