BLASTX nr result
ID: Ophiopogon24_contig00016775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016775 (1208 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT37476.1| hypothetical protein CQW23_21049 [Capsicum baccatum] 52 2e-06 >gb|PHT37476.1| hypothetical protein CQW23_21049 [Capsicum baccatum] Length = 2172 Score = 51.6 bits (122), Expect(2) = 2e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 1141 KLSVA*TSM*KWMCGNTLRDRIRNECIHNKLSVAFIEDK 1025 KL VA M +WMCG T RDR+RNE I NK+ VA +EDK Sbjct: 60 KLKVAEMRMLRWMCGLTKRDRVRNEIIRNKVGVALVEDK 98 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 1005 GHAQQGQLSVSVKRDNRVIVDGAVRTRGRPKR 910 GH + + V+R R+ +DG R RGRPK+ Sbjct: 108 GHVMRRGVDAPVRRCERLALDGFRRKRGRPKK 139