BLASTX nr result
ID: Ophiopogon24_contig00016386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016386 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64034.1| uncharacterized protein A4U43_C07F21420 [Asparagu... 65 2e-10 >gb|ONK64034.1| uncharacterized protein A4U43_C07F21420 [Asparagus officinalis] Length = 120 Score = 64.7 bits (156), Expect = 2e-10 Identities = 38/101 (37%), Positives = 49/101 (48%) Frame = -2 Query: 374 SKTVQEPMSADVRARSSVDGMLAAQGRKSMGHNGGPGLAPYSAGLVGSPLLGEEAPKHAE 195 SKTV EP +RS +DG+++ N P GL A H + Sbjct: 21 SKTVHEPTKPKFHSRSRLDGLMSLHAESP---NANPAELNELIGL---------ANYHVD 68 Query: 194 EGGGGNCVTVEMCKKRKMICYKKCVGRDGRDVGEEHAKGGR 72 + NCVT EMCKK+K+ICY+KC G DVG+ H G R Sbjct: 69 DLNN-NCVTAEMCKKKKVICYRKCPDSPGSDVGKNHLPGNR 108