BLASTX nr result
ID: Ophiopogon24_contig00016324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016324 (630 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253577.1| protein MEI2-like 4 isoform X3 [Asparagus of... 60 8e-07 ref|XP_020253576.1| protein MEI2-like 4 isoform X2 [Asparagus of... 60 8e-07 ref|XP_020253573.1| protein MEI2-like 4 isoform X1 [Asparagus of... 60 8e-07 >ref|XP_020253577.1| protein MEI2-like 4 isoform X3 [Asparagus officinalis] Length = 978 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 627 RSRAYGSEENNQVSPSTSPNGAGFSNGTDVSGSMKGSE 514 RSR +GSEENN SPSTSPN AGFSNGTD++ S+K E Sbjct: 941 RSRTHGSEENNHFSPSTSPNAAGFSNGTDITSSIKDVE 978 >ref|XP_020253576.1| protein MEI2-like 4 isoform X2 [Asparagus officinalis] Length = 979 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 627 RSRAYGSEENNQVSPSTSPNGAGFSNGTDVSGSMKGSE 514 RSR +GSEENN SPSTSPN AGFSNGTD++ S+K E Sbjct: 942 RSRTHGSEENNHFSPSTSPNAAGFSNGTDITSSIKDVE 979 >ref|XP_020253573.1| protein MEI2-like 4 isoform X1 [Asparagus officinalis] ref|XP_020253574.1| protein MEI2-like 4 isoform X1 [Asparagus officinalis] ref|XP_020253575.1| protein MEI2-like 4 isoform X1 [Asparagus officinalis] gb|ONK77914.1| uncharacterized protein A4U43_C02F12230 [Asparagus officinalis] Length = 980 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 627 RSRAYGSEENNQVSPSTSPNGAGFSNGTDVSGSMKGSE 514 RSR +GSEENN SPSTSPN AGFSNGTD++ S+K E Sbjct: 943 RSRTHGSEENNHFSPSTSPNAAGFSNGTDITSSIKDVE 980