BLASTX nr result
ID: Ophiopogon24_contig00016061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016061 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266576.1| WD repeat-containing protein 44-like [Aspara... 72 7e-12 >ref|XP_020266576.1| WD repeat-containing protein 44-like [Asparagus officinalis] gb|ONK79915.1| uncharacterized protein A4U43_C01F11770 [Asparagus officinalis] Length = 577 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +3 Query: 3 AIPWPNGGTNCEPSPDLPSWSRANHNLPTPSNLEDMFSNSRSHNCPS 143 A+PWPNGG +CEPSPDLPSWSR + + SNL+DMF +SRSHN P+ Sbjct: 435 AVPWPNGGPHCEPSPDLPSWSRPTTD-RSASNLQDMFPSSRSHNSPA 480