BLASTX nr result
ID: Ophiopogon24_contig00016028
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00016028 (1175 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019051485.1| PREDICTED: BTB/POZ domain-containing protein... 74 2e-10 ref|XP_020245631.1| BTB/POZ domain-containing protein FBL11 isof... 74 2e-10 ref|XP_019051484.1| PREDICTED: BTB/POZ domain-containing protein... 74 2e-10 ref|XP_020245630.1| BTB/POZ domain-containing protein FBL11 isof... 74 2e-10 ref|XP_020245629.1| BTB/POZ domain-containing protein FBL11 isof... 74 2e-10 gb|KDP42712.1| hypothetical protein JCGZ_23652 [Jatropha curcas] 69 5e-10 ref|XP_008788430.1| PREDICTED: BTB/POZ domain-containing protein... 72 7e-10 ref|XP_008788422.1| PREDICTED: BTB/POZ domain-containing protein... 72 7e-10 ref|XP_008788414.1| PREDICTED: BTB/POZ domain-containing protein... 72 7e-10 ref|XP_010940313.1| PREDICTED: BTB/POZ domain-containing protein... 72 9e-10 gb|ESR43505.1| hypothetical protein CICLE_v10013912mg [Citrus cl... 66 2e-09 gb|ESR43506.1| hypothetical protein CICLE_v10013912mg [Citrus cl... 66 3e-09 ref|XP_015583768.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-09 ref|XP_010654062.1| PREDICTED: BTB/POZ domain-containing protein... 70 3e-09 gb|EEF28381.1| ubiquitin-protein ligase, putative [Ricinus commu... 70 3e-09 ref|XP_010654061.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-09 ref|XP_015583767.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-09 ref|XP_015583766.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-09 ref|XP_015583764.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-09 ref|XP_015583763.1| PREDICTED: BTB/POZ domain-containing protein... 70 4e-09 >ref|XP_019051485.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X7 [Nelumbo nucifera] Length = 940 Score = 73.9 bits (180), Expect = 2e-10 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VTSEGVSSLF+CKA+EDL LRH GRGI+RNFI DAAS Sbjct: 840 LEDCGEVTSEGVSSLFDCKAIEDLSLRHTGRGIQRNFIVDAAS 882 >ref|XP_020245631.1| BTB/POZ domain-containing protein FBL11 isoform X3 [Asparagus officinalis] Length = 941 Score = 73.9 bits (180), Expect = 2e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 127 QNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 ++CGKVT+ GVSSLFNCKAVEDLLLRHNGRGI RN I DAAS Sbjct: 820 ESCGKVTAHGVSSLFNCKAVEDLLLRHNGRGIGRNVIYDAAS 861 >ref|XP_019051484.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X6 [Nelumbo nucifera] Length = 963 Score = 73.9 bits (180), Expect = 2e-10 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VTSEGVSSLF+CKA+EDL LRH GRGI+RNFI DAAS Sbjct: 840 LEDCGEVTSEGVSSLFDCKAIEDLSLRHTGRGIQRNFIVDAAS 882 >ref|XP_020245630.1| BTB/POZ domain-containing protein FBL11 isoform X2 [Asparagus officinalis] Length = 971 Score = 73.9 bits (180), Expect = 2e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 127 QNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 ++CGKVT+ GVSSLFNCKAVEDLLLRHNGRGI RN I DAAS Sbjct: 850 ESCGKVTAHGVSSLFNCKAVEDLLLRHNGRGIGRNVIYDAAS 891 >ref|XP_020245629.1| BTB/POZ domain-containing protein FBL11 isoform X1 [Asparagus officinalis] gb|ONK57396.1| uncharacterized protein A4U43_C09F90 [Asparagus officinalis] Length = 972 Score = 73.9 bits (180), Expect = 2e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 127 QNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 ++CGKVT+ GVSSLFNCKAVEDLLLRHNGRGI RN I DAAS Sbjct: 851 ESCGKVTAHGVSSLFNCKAVEDLLLRHNGRGIGRNVIYDAAS 892 >gb|KDP42712.1| hypothetical protein JCGZ_23652 [Jatropha curcas] Length = 185 Score = 68.9 bits (167), Expect = 5e-10 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -2 Query: 139 TFF-LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 TFF L++CG VT+ GVSSLFNC+A+E +LLRHNG+GI R+FI DAAS Sbjct: 58 TFFQLEDCGDVTATGVSSLFNCRALEHILLRHNGQGIHRSFILDAAS 104 >ref|XP_008788430.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X3 [Phoenix dactylifera] Length = 952 Score = 72.4 bits (176), Expect = 7e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAA 5 L++CGK+TS GVS LFNCKAVEDLLL HNGRGI RNFI DAA Sbjct: 828 LEDCGKITSNGVSFLFNCKAVEDLLLCHNGRGIGRNFICDAA 869 >ref|XP_008788422.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Phoenix dactylifera] Length = 968 Score = 72.4 bits (176), Expect = 7e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAA 5 L++CGK+TS GVS LFNCKAVEDLLL HNGRGI RNFI DAA Sbjct: 846 LEDCGKITSNGVSFLFNCKAVEDLLLCHNGRGIGRNFICDAA 887 >ref|XP_008788414.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X1 [Phoenix dactylifera] Length = 970 Score = 72.4 bits (176), Expect = 7e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAA 5 L++CGK+TS GVS LFNCKAVEDLLL HNGRGI RNFI DAA Sbjct: 846 LEDCGKITSNGVSFLFNCKAVEDLLLCHNGRGIGRNFICDAA 887 >ref|XP_010940313.1| PREDICTED: BTB/POZ domain-containing protein FBL11 [Elaeis guineensis] Length = 970 Score = 72.0 bits (175), Expect = 9e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAA 5 L++CGK+TS GVS LFNCKAVEDLLLRH GRGI RNFI DAA Sbjct: 848 LEDCGKITSNGVSFLFNCKAVEDLLLRHIGRGIGRNFICDAA 889 >gb|ESR43505.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 148 Score = 66.2 bits (160), Expect = 2e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L+ CG +T+ GV+SLFNC A+EDLLLRHNG GI RNFI DAAS Sbjct: 47 LEECGDITAYGVTSLFNCIALEDLLLRHNGPGIPRNFILDAAS 89 >gb|ESR43506.1| hypothetical protein CICLE_v10013912mg [Citrus clementina] Length = 171 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L+ CG +T+ GV+SLFNC A+EDLLLRHNG GI RNFI DAAS Sbjct: 47 LEECGDITAYGVTSLFNCIALEDLLLRHNGPGIPRNFILDAAS 89 >ref|XP_015583768.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X5 [Ricinus communis] Length = 796 Score = 70.1 bits (170), Expect = 3e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 673 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 715 >ref|XP_010654062.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X4 [Vitis vinifera] Length = 802 Score = 70.1 bits (170), Expect = 3e-09 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L+ CG+VT++GV SLF+CKA+EDLLLRHNG GI+RNFI DAAS Sbjct: 673 LEECGEVTADGVISLFDCKALEDLLLRHNGPGIQRNFILDAAS 715 >gb|EEF28381.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 846 Score = 70.1 bits (170), Expect = 3e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 656 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 698 >ref|XP_010654061.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Vitis vinifera] Length = 917 Score = 70.1 bits (170), Expect = 4e-09 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L+ CG+VT++GV SLF+CKA+EDLLLRHNG GI+RNFI DAAS Sbjct: 788 LEECGEVTADGVISLFDCKALEDLLLRHNGPGIQRNFILDAAS 830 >ref|XP_015583767.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X4 [Ricinus communis] Length = 942 Score = 70.1 bits (170), Expect = 4e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 819 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 861 >ref|XP_015583766.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X3 [Ricinus communis] Length = 954 Score = 70.1 bits (170), Expect = 4e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 831 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 873 >ref|XP_015583764.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Ricinus communis] Length = 961 Score = 70.1 bits (170), Expect = 4e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 838 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 880 >ref|XP_015583763.1| PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X1 [Ricinus communis] Length = 970 Score = 70.1 bits (170), Expect = 4e-09 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -2 Query: 130 LQNCGKVTSEGVSSLFNCKAVEDLLLRHNGRGIRRNFISDAAS 2 L++CG+VT+ GVSSLFNC+A+ED+LLRHNGRGI+ +FI DAAS Sbjct: 847 LEDCGEVTTTGVSSLFNCRALEDILLRHNGRGIQSSFILDAAS 889