BLASTX nr result
ID: Ophiopogon24_contig00015773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015773 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272363.1| zinc finger CCCH domain-containing protein 5... 69 2e-10 >ref|XP_020272363.1| zinc finger CCCH domain-containing protein 53-like [Asparagus officinalis] gb|ONK62783.1| uncharacterized protein A4U43_C07F8090 [Asparagus officinalis] Length = 287 Score = 68.6 bits (166), Expect = 2e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +3 Query: 3 LANEESSLVTSNGSSNTHLIASTLLPPSSPLENMASFNSCFFQIPRFS 146 L+NEESSL+ S IASTLLPPSSPLENMASF SCFFQIPRFS Sbjct: 239 LSNEESSLINSG-------IASTLLPPSSPLENMASFKSCFFQIPRFS 279