BLASTX nr result
ID: Ophiopogon24_contig00015499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015499 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269121.1| exocyst complex component SEC6 isoform X1 [A... 71 4e-11 ref|XP_020269124.1| exocyst complex component SEC6 isoform X3 [A... 71 4e-11 gb|ABY60778.1| exocyst complex subunit SEC6, partial [Carica pap... 63 3e-10 ref|XP_008784636.1| PREDICTED: exocyst complex component SEC6 [P... 67 8e-10 ref|XP_010937044.1| PREDICTED: exocyst complex component SEC6 [E... 67 8e-10 ref|XP_010939564.1| PREDICTED: exocyst complex component SEC6 is... 65 5e-09 ref|XP_010939563.1| PREDICTED: exocyst complex component SEC6 is... 65 5e-09 ref|XP_020090383.1| exocyst complex component SEC6 isoform X4 [A... 64 1e-08 ref|XP_020090381.1| exocyst complex component SEC6 isoform X2 [A... 64 1e-08 gb|OAY79293.1| Exocyst complex component SEC6 [Ananas comosus] 64 1e-08 ref|XP_020090380.1| exocyst complex component SEC6 isoform X1 [A... 64 1e-08 ref|XP_021896017.1| exocyst complex component SEC6 isoform X2 [C... 63 2e-08 gb|ABS32232.1| exocyst complex subunit SEC6, partial [Carica pap... 63 2e-08 gb|ABS32227.1| exocyst complex subunit SEC6, partial [Carica pap... 63 2e-08 ref|XP_021896016.1| exocyst complex component SEC6 isoform X1 [C... 63 2e-08 ref|XP_010471190.1| PREDICTED: exocyst complex component SEC6-li... 59 5e-08 ref|XP_009395917.1| PREDICTED: exocyst complex component SEC6 [M... 62 8e-08 ref|XP_023901398.1| exocyst complex component SEC6-like [Quercus... 61 1e-07 ref|XP_021685345.1| exocyst complex component SEC6 [Hevea brasil... 61 1e-07 gb|POE49649.1| exocyst complex component sec6 [Quercus suber] 61 1e-07 >ref|XP_020269121.1| exocyst complex component SEC6 isoform X1 [Asparagus officinalis] Length = 753 Score = 71.2 bits (173), Expect = 4e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IYE+SLVDGNP KTGFVFGK+KSLAASK Y+W+KLGH Sbjct: 717 IYENSLVDGNPAKTGFVFGKLKSLAASKNYIWKKLGH 753 >ref|XP_020269124.1| exocyst complex component SEC6 isoform X3 [Asparagus officinalis] gb|ONK66124.1| uncharacterized protein A4U43_C06F4390 [Asparagus officinalis] Length = 753 Score = 71.2 bits (173), Expect = 4e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IYE+SLVDGNP KTGFVFGK+KSLAASK Y+W+KLGH Sbjct: 717 IYENSLVDGNPAKTGFVFGKLKSLAASKNYIWKKLGH 753 >gb|ABY60778.1| exocyst complex subunit SEC6, partial [Carica papaya] gb|ABY60782.1| exocyst complex subunit SEC6, partial [Carica papaya] Length = 64 Score = 63.2 bits (152), Expect = 3e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP KTGFVF KVKSL+ASKG LWRKL Sbjct: 29 IYENSLVDGNPPKTGFVFPKVKSLSASKGSLWRKL 63 >ref|XP_008784636.1| PREDICTED: exocyst complex component SEC6 [Phoenix dactylifera] Length = 706 Score = 67.4 bits (163), Expect = 8e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IYEHSLVDGNP K GFVFG+VK LAA K YLWRKL H Sbjct: 670 IYEHSLVDGNPPKAGFVFGRVKCLAAPKSYLWRKLAH 706 >ref|XP_010937044.1| PREDICTED: exocyst complex component SEC6 [Elaeis guineensis] Length = 755 Score = 67.4 bits (163), Expect = 8e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IYEHSLVDGNP K GFVFG+VK LAA K YLWRKL H Sbjct: 719 IYEHSLVDGNPPKAGFVFGRVKCLAAPKSYLWRKLAH 755 >ref|XP_010939564.1| PREDICTED: exocyst complex component SEC6 isoform X2 [Elaeis guineensis] Length = 755 Score = 65.1 bits (157), Expect = 5e-09 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IY HSLVDGNP K GFVFG+VK LAA K YLWRKL H Sbjct: 719 IYAHSLVDGNPPKAGFVFGRVKCLAAPKSYLWRKLAH 755 >ref|XP_010939563.1| PREDICTED: exocyst complex component SEC6 isoform X1 [Elaeis guineensis] Length = 756 Score = 65.1 bits (157), Expect = 5e-09 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLGH 425 IY HSLVDGNP K GFVFG+VK LAA K YLWRKL H Sbjct: 720 IYAHSLVDGNPPKAGFVFGRVKCLAAPKSYLWRKLAH 756 >ref|XP_020090383.1| exocyst complex component SEC6 isoform X4 [Ananas comosus] Length = 636 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLG 428 IYE+SLVDGNP K GFVFGKVK LAA KG LWRKLG Sbjct: 601 IYENSLVDGNPPKAGFVFGKVKCLAAPKGSLWRKLG 636 >ref|XP_020090381.1| exocyst complex component SEC6 isoform X2 [Ananas comosus] Length = 715 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLG 428 IYE+SLVDGNP K GFVFGKVK LAA KG LWRKLG Sbjct: 680 IYENSLVDGNPPKAGFVFGKVKCLAAPKGSLWRKLG 715 >gb|OAY79293.1| Exocyst complex component SEC6 [Ananas comosus] Length = 743 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLG 428 IYE+SLVDGNP K GFVFGKVK LAA KG LWRKLG Sbjct: 708 IYENSLVDGNPPKAGFVFGKVKCLAAPKGSLWRKLG 743 >ref|XP_020090380.1| exocyst complex component SEC6 isoform X1 [Ananas comosus] Length = 755 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKLG 428 IYE+SLVDGNP K GFVFGKVK LAA KG LWRKLG Sbjct: 720 IYENSLVDGNPPKAGFVFGKVKCLAAPKGSLWRKLG 755 >ref|XP_021896017.1| exocyst complex component SEC6 isoform X2 [Carica papaya] Length = 447 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP KTGFVF KVKSL+ASKG LWRKL Sbjct: 412 IYENSLVDGNPPKTGFVFPKVKSLSASKGSLWRKL 446 >gb|ABS32232.1| exocyst complex subunit SEC6, partial [Carica papaya] Length = 552 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP KTGFVF KVKSL+ASKG LWRKL Sbjct: 517 IYENSLVDGNPPKTGFVFPKVKSLSASKGSLWRKL 551 >gb|ABS32227.1| exocyst complex subunit SEC6, partial [Carica papaya] Length = 552 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP KTGFVF KVKSL+ASKG LWRKL Sbjct: 517 IYENSLVDGNPPKTGFVFPKVKSLSASKGSLWRKL 551 >ref|XP_021896016.1| exocyst complex component SEC6 isoform X1 [Carica papaya] Length = 558 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP KTGFVF KVKSL+ASKG LWRKL Sbjct: 523 IYENSLVDGNPPKTGFVFPKVKSLSASKGSLWRKL 557 >ref|XP_010471190.1| PREDICTED: exocyst complex component SEC6-like [Camelina sativa] Length = 122 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE++LVDGNP KTGFVF +VK LAA+KG LWRKL Sbjct: 87 IYENTLVDGNPPKTGFVFPRVKCLAANKGSLWRKL 121 >ref|XP_009395917.1| PREDICTED: exocyst complex component SEC6 [Musa acuminata subsp. malaccensis] Length = 753 Score = 61.6 bits (148), Expect = 8e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYEHSLVDGNP KTGFVFGKVK LAA KG +WRKL Sbjct: 718 IYEHSLVDGNPPKTGFVFGKVKCLAAPKG-IWRKL 751 >ref|XP_023901398.1| exocyst complex component SEC6-like [Quercus suber] Length = 756 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+S VDGNP K GFVF KVK L+ASKGYLWRKL Sbjct: 721 IYENSFVDGNPPKAGFVFPKVKCLSASKGYLWRKL 755 >ref|XP_021685345.1| exocyst complex component SEC6 [Hevea brasiliensis] Length = 756 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+SLVDGNP + GFVF KVK L+ASKGYLWRKL Sbjct: 721 IYENSLVDGNPPRAGFVFPKVKYLSASKGYLWRKL 755 >gb|POE49649.1| exocyst complex component sec6 [Quercus suber] Length = 766 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 535 IYEHSLVDGNPTKTGFVFGKVKSLAASKGYLWRKL 431 IYE+S VDGNP K GFVF KVK L+ASKGYLWRKL Sbjct: 731 IYENSFVDGNPPKAGFVFPKVKCLSASKGYLWRKL 765