BLASTX nr result
ID: Ophiopogon24_contig00015450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015450 (520 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245878.1| pentatricopeptide repeat-containing protein ... 70 3e-20 ref|XP_020245879.1| pentatricopeptide repeat-containing protein ... 70 3e-20 ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containi... 49 5e-11 ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containi... 51 9e-11 ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containi... 51 9e-11 ref|XP_010912918.2| PREDICTED: pentatricopeptide repeat-containi... 51 4e-10 ref|XP_010243522.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-09 gb|OVA20525.1| Pentatricopeptide repeat [Macleaya cordata] 46 2e-09 ref|XP_002516878.1| PREDICTED: pentatricopeptide repeat-containi... 48 2e-09 ref|XP_020110488.1| pentatricopeptide repeat-containing protein ... 47 5e-09 gb|OAY69844.1| Pentatricopeptide repeat-containing protein, chlo... 47 1e-08 gb|OAY78205.1| Pentatricopeptide repeat-containing protein, chlo... 47 1e-08 ref|XP_022137654.1| pentatricopeptide repeat-containing protein ... 45 1e-08 emb|CBI14894.3| unnamed protein product, partial [Vitis vinifera] 44 2e-08 ref|XP_010663057.1| PREDICTED: pentatricopeptide repeat-containi... 44 2e-08 ref|XP_021807656.1| pentatricopeptide repeat-containing protein ... 45 2e-08 ref|XP_008239377.1| PREDICTED: pentatricopeptide repeat-containi... 45 2e-08 gb|OWM65464.1| hypothetical protein CDL15_Pgr009054 [Punica gran... 44 5e-08 gb|PKI66629.1| hypothetical protein CRG98_012971, partial [Punic... 44 5e-08 ref|XP_023001232.1| pentatricopeptide repeat-containing protein ... 43 6e-08 >ref|XP_020245878.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK58111.1| uncharacterized protein A4U43_C09F8240 [Asparagus officinalis] Length = 699 Score = 70.5 bits (171), Expect(2) = 3e-20 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVENTLFLDDPDAEL 378 PIR FFK RS T +PKQEGR + QRNRRTSWRIA TEADP+ DDP+AEL Sbjct: 86 PIRVFFKSRSQTL-NPKQEGRVTLQRNRRTSWRIAQTEADPLGKNPSFDDPEAEL 139 Score = 55.5 bits (132), Expect(2) = 3e-20 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 431 VEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 VEEIL+VSRNLPENSTLG+ LGSY GKIGK Sbjct: 154 VEEILKVSRNLPENSTLGDFLGSYVGKIGK 183 >ref|XP_020245879.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Asparagus officinalis] Length = 695 Score = 70.5 bits (171), Expect(2) = 3e-20 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVENTLFLDDPDAEL 378 PIR FFK RS T +PKQEGR + QRNRRTSWRIA TEADP+ DDP+AEL Sbjct: 86 PIRVFFKSRSQTL-NPKQEGRVTLQRNRRTSWRIAQTEADPLGKNPSFDDPEAEL 139 Score = 55.5 bits (132), Expect(2) = 3e-20 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 431 VEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 VEEIL+VSRNLPENSTLG+ LGSY GKIGK Sbjct: 154 VEEILKVSRNLPENSTLGDFLGSYVGKIGK 183 >ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Musa acuminata subsp. malaccensis] Length = 734 Score = 48.9 bits (115), Expect(2) = 5e-11 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 214 PIRAFFKFRSLTQ-QDPKQEGRDSRQRNRRTSWRIAGTEADPVEN 345 PI FF+FRS + DPKQ+GR S QRNRRTSW IA ++ +++ Sbjct: 115 PILEFFRFRSSSSADDPKQDGRLSLQRNRRTSWHIANIDSADLDH 159 Score = 45.8 bits (107), Expect(2) = 5e-11 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V EIL V+R+LPEN+TLGE LG YAG++G+ Sbjct: 182 DGVVAEILGVARSLPENATLGELLGPYAGRVGE 214 >ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Phoenix dactylifera] Length = 756 Score = 50.8 bits (120), Expect(2) = 9e-11 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVE 342 PIR FFK RS T+ DPK+EGR + QRNRR++W IA ++D +E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIE 162 Score = 43.1 bits (100), Expect(2) = 9e-11 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V +I+ ++R LPENSTLGE L S+AGK+G+ Sbjct: 191 DGVVGKIMGIARRLPENSTLGEFLDSFAGKVGE 223 >ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Phoenix dactylifera] Length = 744 Score = 50.8 bits (120), Expect(2) = 9e-11 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVE 342 PIR FFK RS T+ DPK+EGR + QRNRR++W IA ++D +E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIE 162 Score = 43.1 bits (100), Expect(2) = 9e-11 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V +I+ ++R LPENSTLGE L S+AGK+G+ Sbjct: 191 DGVVGKIMGIARRLPENSTLGEFLDSFAGKVGE 223 >ref|XP_010912918.2| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Elaeis guineensis] Length = 779 Score = 50.8 bits (120), Expect(2) = 4e-10 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVE 342 PI FFK RS TQ DPK+EGR + QRNRR+SW IA E+D +E Sbjct: 159 PILNFFKSRSETQ-DPKREGRLTLQRNRRSSWHIADFESDDLE 200 Score = 40.8 bits (94), Expect(2) = 4e-10 Identities = 18/31 (58%), Positives = 25/31 (80%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKI 514 D V +I+ ++R+LPENSTLGE L S+AGK+ Sbjct: 226 DGVVGKIMGIARSLPENSTLGEFLDSFAGKV 256 >ref|XP_010243522.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Nelumbo nucifera] Length = 710 Score = 47.4 bits (111), Expect(2) = 1e-09 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +2 Query: 401 ILDSRGGDSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 + DS + + EIL+++RN PEN TLGE LGSYAGKIG+ Sbjct: 154 VSDSCPAEGILAEILQIARNPPENLTLGELLGSYAGKIGE 193 Score = 42.7 bits (99), Expect(2) = 1e-09 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 PI FFK RS TQ DP +EGR Q+NRRTSW +A Sbjct: 95 PIVQFFKSRSATQ-DPGKEGRVHLQKNRRTSWHLA 128 >gb|OVA20525.1| Pentatricopeptide repeat [Macleaya cordata] Length = 723 Score = 45.8 bits (107), Expect(2) = 2e-09 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +2 Query: 431 VEEILRVSRNLPENSTLGEHLG-SYAGKIGK 520 VEEIL+++RN+PENSTLGE LG SY GKIG+ Sbjct: 183 VEEILQLARNVPENSTLGELLGSSYVGKIGE 213 Score = 43.5 bits (101), Expect(2) = 2e-09 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 12/61 (19%) Frame = +1 Query: 214 PIRAFFKFRSLTQ-QDPKQEGRDSRQRNRRTSWRIAGTEA-----------DPVENTLFL 357 PI FFK RS+T +DP+ EGR Q+NRR+SWR+A ++ + EN L L Sbjct: 110 PIIKFFKTRSVTPTEDPEYEGRTLLQKNRRSSWRLADIKSIETDAEEEEYEEAEENELLL 169 Query: 358 D 360 D Sbjct: 170 D 170 >ref|XP_002516878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Ricinus communis] gb|EEF45492.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 714 Score = 48.1 bits (113), Expect(2) = 2e-09 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 PI FFK R+ T QDP EG+ S QRNRRT WR+A Sbjct: 94 PILKFFKSRTSTTQDPPHEGKFSLQRNRRTQWRLA 128 Score = 41.2 bits (95), Expect(2) = 2e-09 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +2 Query: 401 ILDSRGGDSE---VEEILRVSRNLPENSTLGEHLGSYAGKI 514 +L S DS V EIL ++R LPEN+ LGE LG Y GKI Sbjct: 149 LLGSSNSDSSKGIVREILNLARELPENTILGEQLGHYKGKI 189 >ref|XP_020110488.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Ananas comosus] Length = 715 Score = 47.4 bits (111), Expect(2) = 5e-09 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V EI+R++R+LPENSTLGE LGSY G++G+ Sbjct: 161 DGVVGEIMRLARSLPENSTLGECLGSYEGRVGE 193 Score = 40.8 bits (94), Expect(2) = 5e-09 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +1 Query: 214 PIRAFF-KFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 P +FF + RS DPK+EGR S QRNRR+SW +A Sbjct: 89 PFLSFFNRRRSAPVDDPKREGRPSLQRNRRSSWHLA 124 >gb|OAY69844.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 729 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V EI+R++R+LPENSTLGE LGSY G++G+ Sbjct: 175 DGVVGEIMRLARSLPENSTLGECLGSYEGRVGE 207 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 214 PIRAFF-KFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 P +FF + R DPK+EGR S QRNRR+SW +A Sbjct: 102 PFLSFFNRRRGAPVDDPKREGRSSLQRNRRSSWHLA 137 >gb|OAY78205.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 834 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V EI+R++R+LPENSTLGE LGSY G++G+ Sbjct: 161 DGVVGEIMRLARSLPENSTLGECLGSYEGRVGE 193 Score = 39.3 bits (90), Expect(2) = 1e-08 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 214 PIRAFF-KFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 P +FF + R DPK+EGR S QRNRR+SW +A Sbjct: 89 PFLSFFNRRRGAPVDDPKREGRPSLQRNRRSSWHLA 124 >ref|XP_022137654.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Momordica charantia] ref|XP_022137656.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Momordica charantia] Length = 714 Score = 45.1 bits (105), Expect(2) = 1e-08 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIA-GTE-ADPVENTL 351 P+ FFK R+ T QDP++E + S Q+NRR+SW +A G+E AD E T+ Sbjct: 91 PLFRFFKSRTSTTQDPQRESKVSLQKNRRSSWHLASGSEFADEAEITI 138 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 D V +I+R +RNLPEN+TLGE L + G+IG+ Sbjct: 157 DGVVGDIMRTARNLPENTTLGEALADFDGRIGE 189 >emb|CBI14894.3| unnamed protein product, partial [Vitis vinifera] Length = 746 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +2 Query: 437 EILRVSRNLPENSTLGEHLGSYAGKIGK 520 EIL +RNLPENSTLGE LG Y G++G+ Sbjct: 144 EILHFARNLPENSTLGEVLGPYVGRVGE 171 Score = 42.7 bits (99), Expect(2) = 2e-08 Identities = 24/47 (51%), Positives = 30/47 (63%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVENTLF 354 PI FFK R+ TQ DP+ E + S Q+NRR SWR+A T DP + F Sbjct: 77 PILRFFKSRTSTQ-DPRFESKFSLQKNRRPSWRLAST-TDPESDAEF 121 >ref|XP_010663057.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Vitis vinifera] ref|XP_019082196.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Vitis vinifera] emb|CAN76897.1| hypothetical protein VITISV_010606 [Vitis vinifera] Length = 692 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +2 Query: 437 EILRVSRNLPENSTLGEHLGSYAGKIGK 520 EIL +RNLPENSTLGE LG Y G++G+ Sbjct: 144 EILHFARNLPENSTLGEVLGPYVGRVGE 171 Score = 42.7 bits (99), Expect(2) = 2e-08 Identities = 24/47 (51%), Positives = 30/47 (63%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVENTLF 354 PI FFK R+ TQ DP+ E + S Q+NRR SWR+A T DP + F Sbjct: 77 PILRFFKSRTSTQ-DPRFESKFSLQKNRRPSWRLAST-TDPESDAEF 121 >ref|XP_021807656.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Prunus avium] Length = 722 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 PI FFK RS TQ DP++EG+ S Q+NRR+SWR+A Sbjct: 99 PILRFFKSRSSTQ-DPQREGKLSLQKNRRSSWRLA 132 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 407 DSRGGDSE-VEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 DSR E VEEIL+ +R LP+N TLGE LG + G++G+ Sbjct: 164 DSRALSEEIVEEILQKARTLPQNLTLGEVLGGFEGRVGE 202 >ref|XP_008239377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Prunus mume] Length = 722 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIA 318 PI FFK RS TQ DP++EG+ S Q+NRR+SWR+A Sbjct: 99 PILRFFKSRSSTQ-DPQREGKLSLQKNRRSSWRLA 132 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 407 DSRGGDSE-VEEILRVSRNLPENSTLGEHLGSYAGKIGK 520 DSR E VEEIL+ +R LP+N TLGE LG + G++G+ Sbjct: 164 DSRALSEEIVEEILQKARTLPQNLTLGEVLGGFEGRVGE 202 >gb|OWM65464.1| hypothetical protein CDL15_Pgr009054 [Punica granatum] Length = 718 Score = 43.9 bits (102), Expect(2) = 5e-08 Identities = 27/65 (41%), Positives = 32/65 (49%) Frame = +1 Query: 124 EQDQSYRQEELLXXXXXXXXXXXXXXXXXXPIRAFFKFRSLTQQDPKQEGRDSRQRNRRT 303 EQDQ Q E PIR FFK R+ TQ DP E R S Q+NRR+ Sbjct: 64 EQDQDGEQAEPEEDGVEGGDGEVDEEDDDDPIRRFFKSRATTQ-DPPLEARFSLQKNRRS 122 Query: 304 SWRIA 318 SWR++ Sbjct: 123 SWRLS 127 Score = 40.8 bits (94), Expect(2) = 5e-08 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +2 Query: 437 EILRVSRNLPENSTLGEHLGSYAGKI 514 EILR++R+LPENSTLGE LG + G I Sbjct: 166 EILRIARDLPENSTLGEFLGDFNGSI 191 >gb|PKI66629.1| hypothetical protein CRG98_012971, partial [Punica granatum] Length = 415 Score = 43.9 bits (102), Expect(2) = 5e-08 Identities = 27/65 (41%), Positives = 32/65 (49%) Frame = +1 Query: 124 EQDQSYRQEELLXXXXXXXXXXXXXXXXXXPIRAFFKFRSLTQQDPKQEGRDSRQRNRRT 303 EQDQ Q E PIR FFK R+ TQ DP E R S Q+NRR+ Sbjct: 64 EQDQDGEQAEPEEDGVEGGDGEVDEEDDDDPIRRFFKSRATTQ-DPPLEARFSLQKNRRS 122 Query: 304 SWRIA 318 SWR++ Sbjct: 123 SWRLS 127 Score = 40.8 bits (94), Expect(2) = 5e-08 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +2 Query: 437 EILRVSRNLPENSTLGEHLGSYAGKI 514 EILR++R+LPENSTLGE LG + G I Sbjct: 166 EILRIARDLPENSTLGEFLGDFNGSI 191 >ref|XP_023001232.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Cucurbita maxima] Length = 723 Score = 43.1 bits (100), Expect(2) = 6e-08 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +1 Query: 214 PIRAFFKFRSLTQQDPKQEGRDSRQRNRRTSWRIAGTEADPVENTLFLDD 363 P+ FFK R+ T QDP E + S Q+NRR+SW +A VE + DD Sbjct: 101 PLVRFFKSRNSTTQDPLPESKLSLQKNRRSSWHLASEVECSVEAEIAPDD 150 Score = 41.2 bits (95), Expect(2) = 6e-08 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +2 Query: 422 DSEVEEILRVSRNLPENSTLGEHLGSYAGKI 514 D V +I+R +RNLP+N+TLGE LG + GKI Sbjct: 167 DGVVGDIVRTARNLPQNTTLGEALGDFEGKI 197