BLASTX nr result
ID: Ophiopogon24_contig00015449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015449 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245879.1| pentatricopeptide repeat-containing protein ... 92 2e-18 ref|XP_020245878.1| pentatricopeptide repeat-containing protein ... 92 2e-18 ref|XP_010912918.2| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_020245879.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Asparagus officinalis] Length = 695 Score = 91.7 bits (226), Expect = 2e-18 Identities = 46/76 (60%), Positives = 55/76 (72%) Frame = +2 Query: 269 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 448 PIR FF+ RS T +P+QEGR + QRNRRTSWRIA+ EADP+ P DDPEAEL S Sbjct: 86 PIRVFFKSRSQTL-NPKQEGRVTLQRNRRTSWRIAQTEADPLGKNPSFDDPEAELVDSSE 144 Query: 449 SVDTGSDSVVEEILRV 496 V+ GS +VEEIL+V Sbjct: 145 EVEVGSFGIVEEILKV 160 >ref|XP_020245878.1| pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK58111.1| uncharacterized protein A4U43_C09F8240 [Asparagus officinalis] Length = 699 Score = 91.7 bits (226), Expect = 2e-18 Identities = 46/76 (60%), Positives = 55/76 (72%) Frame = +2 Query: 269 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 448 PIR FF+ RS T +P+QEGR + QRNRRTSWRIA+ EADP+ P DDPEAEL S Sbjct: 86 PIRVFFKSRSQTL-NPKQEGRVTLQRNRRTSWRIAQTEADPLGKNPSFDDPEAELVDSSE 144 Query: 449 SVDTGSDSVVEEILRV 496 V+ GS +VEEIL+V Sbjct: 145 EVEVGSFGIVEEILKV 160 >ref|XP_010912918.2| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Elaeis guineensis] Length = 779 Score = 59.7 bits (143), Expect = 3e-07 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 2/78 (2%) Frame = +2 Query: 269 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 448 PI FF+ RS TQ DP++EGR + QRNRR+SW IA+ E+D +E +D +A S++ Sbjct: 159 PILNFFKSRSETQ-DPKREGRLTLQRNRRSSWHIADFESDDLEEEEEEEDVQAVELDSDS 217 Query: 449 SV--DTGSDSVVEEILRV 496 V T D VV +I+ + Sbjct: 218 GVPEPTSEDGVVGKIMGI 235 >ref|XP_009415073.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Musa acuminata subsp. malaccensis] Length = 734 Score = 58.9 bits (141), Expect = 5e-07 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 269 PIRAFFRFRSHTQPD-PEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSE 445 PI FFRFRS + D P+Q+GR S QRNRRTSW IA I++ ++ D+ + S Sbjct: 115 PILEFFRFRSSSSADDPKQDGRLSLQRNRRTSWHIANIDSADLDHDGLEDEGQVLEPPSP 174 Query: 446 ASVDTGSDSVVEEILRV 496 + D VV EIL V Sbjct: 175 SPPQPAEDGVVAEILGV 191 >ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Phoenix dactylifera] Length = 744 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/72 (43%), Positives = 47/72 (65%) Frame = +2 Query: 269 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 448 PIR FF+ RS T+ DP++EGR + QRNRR++W IA++++D +E ++ E E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIE-----EEEEEEEEEEVQ 174 Query: 449 SVDTGSDSVVEE 484 +V+ SDS V E Sbjct: 175 AVEPDSDSGVPE 186 >ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Phoenix dactylifera] Length = 756 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/72 (43%), Positives = 47/72 (65%) Frame = +2 Query: 269 PIRAFFRFRSHTQPDPEQEGRASRQRNRRTSWRIAEIEADPVETTPFLDDPEAELASSEA 448 PIR FF+ RS T+ DP++EGR + QRNRR++W IA++++D +E ++ E E Sbjct: 121 PIRNFFKSRSETR-DPKREGRLTLQRNRRSTWHIADLQSDDIE-----EEEEEEEEEEVQ 174 Query: 449 SVDTGSDSVVEE 484 +V+ SDS V E Sbjct: 175 AVEPDSDSGVPE 186