BLASTX nr result
ID: Ophiopogon24_contig00015232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015232 (609 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77809.1| uncharacterized protein A4U43_C02F10920 [Asparagu... 80 6e-15 >gb|ONK77809.1| uncharacterized protein A4U43_C02F10920 [Asparagus officinalis] Length = 197 Score = 79.7 bits (195), Expect = 6e-15 Identities = 45/91 (49%), Positives = 58/91 (63%) Frame = +2 Query: 335 QQEEDPLERQFRAAEQERNTYLESVPRHRRSRSADSGLLRNNGILGISPKKLLSSLQQCR 514 ++E+DPL++QF++ E++ Y ES+PR RRS S S L +L SPKKL+SSLQQC Sbjct: 11 EEEQDPLKKQFQSLEEDWKCYKESIPRDRRSHSVVSLEL----LLSTSPKKLISSLQQCH 66 Query: 515 SPCSVEGRAAPRTGKIEGRSLLEALETAKDD 607 SP +T I GRSLLE LE KDD Sbjct: 67 SP-------RAKTNNIRGRSLLEELENVKDD 90