BLASTX nr result
ID: Ophiopogon24_contig00015069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00015069 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020692942.1| uncharacterized protein LOC110107118 [Dendro... 138 8e-36 gb|PKU66471.1| Geranylgeranyl diphosphate reductase, chloroplast... 138 2e-35 gb|OVA13770.1| Aromatic-ring hydroxylase-like [Macleaya cordata] 134 3e-34 gb|KVI06153.1| hypothetical protein Ccrd_015501 [Cynara carduncu... 132 1e-33 gb|PKA61843.1| Geranylgeranyl diphosphate reductase, chloroplast... 132 1e-33 gb|KCW87296.1| hypothetical protein EUGRSUZ_B03789, partial [Euc... 131 2e-33 ref|XP_023747237.1| geranylgeranyl diphosphate reductase, chloro... 132 2e-33 ref|XP_010045145.1| PREDICTED: geranylgeranyl diphosphate reduct... 131 3e-33 gb|PIN16886.1| Kynurenine 3-monooxygenase [Handroanthus impetigi... 130 4e-33 ref|XP_017249177.1| PREDICTED: geranylgeranyl diphosphate reduct... 130 6e-33 gb|PHT60235.1| Geranylgeranyl diphosphate reductase, chloroplast... 130 6e-33 ref|XP_016555399.1| PREDICTED: geranylgeranyl diphosphate reduct... 130 6e-33 gb|PIA60055.1| hypothetical protein AQUCO_00400732v1 [Aquilegia ... 130 8e-33 ref|XP_019246471.1| PREDICTED: geranylgeranyl diphosphate reduct... 130 9e-33 ref|XP_021984188.1| uncharacterized protein LOC110879946 [Helian... 130 9e-33 ref|XP_008806236.1| PREDICTED: geranylgeranyl diphosphate reduct... 130 9e-33 ref|XP_015068166.1| PREDICTED: geranylgeranyl diphosphate reduct... 130 1e-32 ref|XP_011089077.2| LOW QUALITY PROTEIN: geranylgeranyl diphosph... 129 1e-32 ref|XP_022876635.1| geranylgeranyl diphosphate reductase, chloro... 129 2e-32 ref|XP_009779056.1| PREDICTED: geranylgeranyl diphosphate reduct... 129 2e-32 >ref|XP_020692942.1| uncharacterized protein LOC110107118 [Dendrobium catenatum] Length = 457 Score = 138 bits (348), Expect = 8e-36 Identities = 65/77 (84%), Positives = 71/77 (92%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYLLERSP G+KPCGGAIPLCMLDEF+IP+ L+DRRVTRMRI+SPSNL DFGKTLRP Sbjct: 69 VETYLLERSPDGSKPCGGAIPLCMLDEFSIPEELIDRRVTRMRIISPSNLHADFGKTLRP 128 Query: 443 HEHIPMLRREVLDSFLR 493 EHIPMLRREVLD+FLR Sbjct: 129 GEHIPMLRREVLDAFLR 145 >gb|PKU66471.1| Geranylgeranyl diphosphate reductase, chloroplastic [Dendrobium catenatum] Length = 546 Score = 138 bits (348), Expect = 2e-35 Identities = 65/77 (84%), Positives = 71/77 (92%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYLLERSP G+KPCGGAIPLCMLDEF+IP+ L+DRRVTRMRI+SPSNL DFGKTLRP Sbjct: 69 VETYLLERSPDGSKPCGGAIPLCMLDEFSIPEELIDRRVTRMRIISPSNLHADFGKTLRP 128 Query: 443 HEHIPMLRREVLDSFLR 493 EHIPMLRREVLD+FLR Sbjct: 129 GEHIPMLRREVLDAFLR 145 >gb|OVA13770.1| Aromatic-ring hydroxylase-like [Macleaya cordata] Length = 452 Score = 134 bits (337), Expect = 3e-34 Identities = 61/77 (79%), Positives = 73/77 (94%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + T+L+ERSP+GAKPCGGAIPLCMLDEF+IP L+DR+VT+M+I+SPSNLTVDFGKTL+P Sbjct: 70 IETFLIERSPSGAKPCGGAIPLCMLDEFSIPLDLIDRKVTQMKIISPSNLTVDFGKTLKP 129 Query: 443 HEHIPMLRREVLDSFLR 493 HE+I MLRREVLDSFLR Sbjct: 130 HEYIAMLRREVLDSFLR 146 >gb|KVI06153.1| hypothetical protein Ccrd_015501 [Cynara cardunculus var. scolymus] Length = 451 Score = 132 bits (333), Expect = 1e-33 Identities = 64/77 (83%), Positives = 70/77 (90%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYL ERSPTGAKPCGGAIPLCMLDEF+IP LVDR+VT M+IVSPSNLTVDFGKTL+ Sbjct: 65 VETYLFERSPTGAKPCGGAIPLCMLDEFSIPPELVDRKVTHMKIVSPSNLTVDFGKTLKS 124 Query: 443 HEHIPMLRREVLDSFLR 493 +E+I MLRREVLDSFLR Sbjct: 125 NEYISMLRREVLDSFLR 141 >gb|PKA61843.1| Geranylgeranyl diphosphate reductase, chloroplastic [Apostasia shenzhenica] Length = 467 Score = 132 bits (333), Expect = 1e-33 Identities = 61/77 (79%), Positives = 71/77 (92%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYL+ERSP+G+KPCGGAIPLCML+EF+IP L+DRRVT+MRI SPSN+T DFG++LRP Sbjct: 77 VETYLIERSPSGSKPCGGAIPLCMLEEFSIPADLIDRRVTQMRIFSPSNITADFGRSLRP 136 Query: 443 HEHIPMLRREVLDSFLR 493 EHIPMLRREVLDSFLR Sbjct: 137 GEHIPMLRREVLDSFLR 153 >gb|KCW87296.1| hypothetical protein EUGRSUZ_B03789, partial [Eucalyptus grandis] Length = 410 Score = 131 bits (330), Expect = 2e-33 Identities = 62/77 (80%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L ERSP+ AKPCGGAIPLCMLDEF +P SLVDR VT MR++SPSN+TVDFGKTLRP Sbjct: 26 VETFLFERSPSSAKPCGGAIPLCMLDEFDLPHSLVDRHVTEMRVISPSNITVDFGKTLRP 85 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 86 HEFIAMLRREVLDSFLR 102 >ref|XP_023747237.1| geranylgeranyl diphosphate reductase, chloroplastic-like [Lactuca sativa] Length = 460 Score = 132 bits (332), Expect = 2e-33 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYL ERSP+GAKPCGGAIPLCMLDEF+IP LVDR+VT M+I+SPSNLTVDFGKTL+ Sbjct: 71 VETYLFERSPSGAKPCGGAIPLCMLDEFSIPPELVDRKVTHMKIISPSNLTVDFGKTLKS 130 Query: 443 HEHIPMLRREVLDSFLR 493 HE+I MLRREVLDS+LR Sbjct: 131 HEYISMLRREVLDSYLR 147 >ref|XP_010045145.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Eucalyptus grandis] Length = 450 Score = 131 bits (330), Expect = 3e-33 Identities = 62/77 (80%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L ERSP+ AKPCGGAIPLCMLDEF +P SLVDR VT MR++SPSN+TVDFGKTLRP Sbjct: 66 VETFLFERSPSSAKPCGGAIPLCMLDEFDLPHSLVDRHVTEMRVISPSNITVDFGKTLRP 125 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 126 HEFIAMLRREVLDSFLR 142 >gb|PIN16886.1| Kynurenine 3-monooxygenase [Handroanthus impetiginosus] Length = 398 Score = 130 bits (327), Expect = 4e-33 Identities = 59/77 (76%), Positives = 69/77 (89%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + TY+ ERSP AKPCGGAIPLCMLDEF+IP L+DR+VT+M+I+SPSNLTVDFGKTL+P Sbjct: 65 IETYIFERSPEAAKPCGGAIPLCMLDEFSIPSDLIDRKVTQMKIISPSNLTVDFGKTLKP 124 Query: 443 HEHIPMLRREVLDSFLR 493 HE I M+RREVLDSFLR Sbjct: 125 HEFISMVRREVLDSFLR 141 >ref|XP_017249177.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Daucus carota subsp. sativus] gb|KZM96171.1| hypothetical protein DCAR_019413 [Daucus carota subsp. sativus] Length = 451 Score = 130 bits (328), Expect = 6e-33 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L ERSP+GAKPCGGAIPLCMLDEF IP LVDR+VT M+I+SPSNLTVDFGKTL+P Sbjct: 62 VETFLFERSPSGAKPCGGAIPLCMLDEFDIPIELVDRKVTHMKIISPSNLTVDFGKTLKP 121 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDS+LR Sbjct: 122 HEFISMLRREVLDSYLR 138 >gb|PHT60235.1| Geranylgeranyl diphosphate reductase, chloroplastic [Capsicum baccatum] gb|PHU30306.1| Geranylgeranyl diphosphate reductase, chloroplastic [Capsicum chinense] Length = 456 Score = 130 bits (328), Expect = 6e-33 Identities = 63/77 (81%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + TYL ERSP AKPCGGAIPLCMLDEF+IP L+DRRVT+MRIVSPSNL VDFGKTL+P Sbjct: 68 IETYLFERSPATAKPCGGAIPLCMLDEFSIPLHLIDRRVTQMRIVSPSNLVVDFGKTLKP 127 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 128 HEFIAMLRREVLDSFLR 144 >ref|XP_016555399.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Capsicum annuum] gb|PHT94801.1| Geranylgeranyl diphosphate reductase, chloroplastic [Capsicum annuum] Length = 456 Score = 130 bits (328), Expect = 6e-33 Identities = 63/77 (81%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + TYL ERSP AKPCGGAIPLCMLDEF+IP L+DRRVT+MRIVSPSNL VDFGKTL+P Sbjct: 68 IETYLFERSPATAKPCGGAIPLCMLDEFSIPLHLIDRRVTQMRIVSPSNLVVDFGKTLKP 127 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 128 HEFIAMLRREVLDSFLR 144 >gb|PIA60055.1| hypothetical protein AQUCO_00400732v1 [Aquilegia coerulea] Length = 448 Score = 130 bits (327), Expect = 8e-33 Identities = 60/77 (77%), Positives = 71/77 (92%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L+ERSP GAKPCGGAIPLCMLDEF+IP L+DR+VT+M+I+SPSNLTVDFGKTL+ Sbjct: 66 VETFLIERSPAGAKPCGGAIPLCMLDEFSIPLDLIDRKVTKMKIISPSNLTVDFGKTLKS 125 Query: 443 HEHIPMLRREVLDSFLR 493 HE+I MLRREVLDS+LR Sbjct: 126 HEYIAMLRREVLDSYLR 142 >ref|XP_019246471.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Nicotiana attenuata] gb|OIT08000.1| geranylgeranyl diphosphate reductase, chloroplastic [Nicotiana attenuata] Length = 453 Score = 130 bits (327), Expect = 9e-33 Identities = 62/77 (80%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L ERSP AKPCGGAIPLCMLDEF+IP L+DRRVT+MRI+SPSNL VDFGKTL+P Sbjct: 65 VETFLFERSPASAKPCGGAIPLCMLDEFSIPYHLIDRRVTQMRIISPSNLVVDFGKTLKP 124 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 125 HEFIAMLRREVLDSFLR 141 >ref|XP_021984188.1| uncharacterized protein LOC110879946 [Helianthus annuus] gb|OTG16635.1| putative geranylgeranyl reductase, plant/prokaryotic [Helianthus annuus] Length = 458 Score = 130 bits (327), Expect = 9e-33 Identities = 59/77 (76%), Positives = 71/77 (92%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + TYL ERSP+GAKPCGGAIPLCML+EF+IP L+DR+VT M+I+SPSNLTVDFGKTL+P Sbjct: 68 IETYLFERSPSGAKPCGGAIPLCMLEEFSIPPDLIDRKVTHMKIISPSNLTVDFGKTLKP 127 Query: 443 HEHIPMLRREVLDSFLR 493 +E+I MLRREVLDS+LR Sbjct: 128 NEYISMLRREVLDSYLR 144 >ref|XP_008806236.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Phoenix dactylifera] Length = 461 Score = 130 bits (327), Expect = 9e-33 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V TYL+ERSP G+KPCGGAIPLCMLDEF++P LVDRRVTRMRI SPSNL VDFG++LR Sbjct: 65 VETYLIERSPAGSKPCGGAIPLCMLDEFSLPAHLVDRRVTRMRIFSPSNLAVDFGRSLRH 124 Query: 443 HEHIPMLRREVLDSFLR 493 EHIPMLRREVLD+FLR Sbjct: 125 GEHIPMLRREVLDAFLR 141 >ref|XP_015068166.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Solanum pennellii] Length = 451 Score = 130 bits (326), Expect = 1e-32 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + T+L ERSP AKPCGGAIPLCMLDEF+IP +L+DRRVT+MRIVSPSNL VDFGKTL+P Sbjct: 63 IETFLFERSPATAKPCGGAIPLCMLDEFSIPLNLIDRRVTQMRIVSPSNLVVDFGKTLKP 122 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 123 HEFIAMLRREVLDSFLR 139 >ref|XP_011089077.2| LOW QUALITY PROTEIN: geranylgeranyl diphosphate reductase, chloroplastic-like [Sesamum indicum] Length = 444 Score = 129 bits (325), Expect = 1e-32 Identities = 59/77 (76%), Positives = 69/77 (89%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + TYL ER+P AKPCGGAIPLCMLDEF+IP L+DR+VT+M+I+SPSNLTVDFGKTL+P Sbjct: 70 IETYLFERNPEAAKPCGGAIPLCMLDEFSIPSHLIDRKVTQMKIISPSNLTVDFGKTLKP 129 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLD+FLR Sbjct: 130 HEFISMLRREVLDNFLR 146 >ref|XP_022876635.1| geranylgeranyl diphosphate reductase, chloroplastic-like [Olea europaea var. sylvestris] ref|XP_022876636.1| geranylgeranyl diphosphate reductase, chloroplastic-like [Olea europaea var. sylvestris] Length = 452 Score = 129 bits (325), Expect = 2e-32 Identities = 60/77 (77%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 + T+L ERSP AKPCGGAIPLCMLDEF+IP L+DRRVT M+I+SPSNLTVDFGKTL+ Sbjct: 64 IETFLFERSPEAAKPCGGAIPLCMLDEFSIPHHLIDRRVTHMKIISPSNLTVDFGKTLKS 123 Query: 443 HEHIPMLRREVLDSFLR 493 HE IPMLRREVLD+FLR Sbjct: 124 HEFIPMLRREVLDNFLR 140 >ref|XP_009779056.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Nicotiana sylvestris] ref|XP_016444729.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Nicotiana tabacum] Length = 453 Score = 129 bits (325), Expect = 2e-32 Identities = 61/77 (79%), Positives = 68/77 (88%) Frame = +2 Query: 263 VTTYLLERSPTGAKPCGGAIPLCMLDEFAIPDSLVDRRVTRMRIVSPSNLTVDFGKTLRP 442 V T+L ERSP AKPCGGAIPLCMLDEF++P L+DRRVT+MRI+SPSNL VDFGKTL+P Sbjct: 65 VETFLFERSPASAKPCGGAIPLCMLDEFSLPYHLIDRRVTQMRIISPSNLVVDFGKTLKP 124 Query: 443 HEHIPMLRREVLDSFLR 493 HE I MLRREVLDSFLR Sbjct: 125 HEFIAMLRREVLDSFLR 141