BLASTX nr result
ID: Ophiopogon24_contig00014760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014760 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA55805.1| hypothetical protein AQUCO_00700256v1 [Aquilegia ... 73 3e-12 emb|CBI17485.3| unnamed protein product, partial [Vitis vinifera] 71 1e-11 ref|XP_010649120.1| PREDICTED: uncharacterized protein LOC100265... 71 2e-11 ref|XP_019075068.1| PREDICTED: uncharacterized protein LOC100265... 71 2e-11 ref|XP_023749086.1| GTPase ERA-like, chloroplastic [Lactuca sati... 71 2e-11 ref|XP_002264259.1| PREDICTED: uncharacterized protein LOC100265... 71 2e-11 gb|KDO70991.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 gb|KDO70990.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 dbj|GAY42663.1| hypothetical protein CUMW_068660 [Citrus unshiu] 71 2e-11 dbj|GAY42664.1| hypothetical protein CUMW_068650 [Citrus unshiu] 71 2e-11 gb|KDO70988.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 gb|ESR38875.1| hypothetical protein CICLE_v10025723mg [Citrus cl... 71 2e-11 gb|ESR38877.1| hypothetical protein CICLE_v10025723mg [Citrus cl... 71 2e-11 gb|KDO70987.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 dbj|GAY42660.1| hypothetical protein CUMW_068650 [Citrus unshiu]... 71 2e-11 gb|KDO70984.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 ref|XP_006466832.1| PREDICTED: GTPase Era [Citrus sinensis] 71 2e-11 ref|XP_006425634.1| GTPase ERA-like, chloroplastic [Citrus cleme... 71 2e-11 gb|KDO70983.1| hypothetical protein CISIN_1g014942mg [Citrus sin... 71 2e-11 ref|XP_012845273.1| PREDICTED: GTPase Era, mitochondrial [Erythr... 71 2e-11 >gb|PIA55805.1| hypothetical protein AQUCO_00700256v1 [Aquilegia coerulea] Length = 327 Score = 73.2 bits (178), Expect = 3e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQRWI 358 DI SEHPERFF+ EIVREKIFMQYRNEVPYACQ WI Sbjct: 292 DIASEHPERFFIAEIVREKIFMQYRNEVPYACQVWI 327 >emb|CBI17485.3| unnamed protein product, partial [Vitis vinifera] Length = 320 Score = 71.2 bits (173), Expect = 1e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEIVREKIFMQYRNEVPYACQ Sbjct: 199 DIVSEHPERFFVGEIVREKIFMQYRNEVPYACQ 231 >ref|XP_010649120.1| PREDICTED: uncharacterized protein LOC100265087 isoform X3 [Vitis vinifera] Length = 384 Score = 71.2 bits (173), Expect = 2e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEIVREKIFMQYRNEVPYACQ Sbjct: 314 DIVSEHPERFFVGEIVREKIFMQYRNEVPYACQ 346 >ref|XP_019075068.1| PREDICTED: uncharacterized protein LOC100265087 isoform X2 [Vitis vinifera] Length = 397 Score = 71.2 bits (173), Expect = 2e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEIVREKIFMQYRNEVPYACQ Sbjct: 276 DIVSEHPERFFVGEIVREKIFMQYRNEVPYACQ 308 >ref|XP_023749086.1| GTPase ERA-like, chloroplastic [Lactuca sativa] gb|PLY62161.1| hypothetical protein LSAT_2X77400 [Lactuca sativa] Length = 413 Score = 71.2 bits (173), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DITSEHPERFF+GEIVREKIFMQ+RNEVPYACQ Sbjct: 292 DITSEHPERFFIGEIVREKIFMQFRNEVPYACQ 324 >ref|XP_002264259.1| PREDICTED: uncharacterized protein LOC100265087 isoform X1 [Vitis vinifera] Length = 435 Score = 71.2 bits (173), Expect = 2e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEIVREKIFMQYRNEVPYACQ Sbjct: 314 DIVSEHPERFFVGEIVREKIFMQYRNEVPYACQ 346 >gb|KDO70991.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 348 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|KDO70990.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 363 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >dbj|GAY42663.1| hypothetical protein CUMW_068660 [Citrus unshiu] Length = 384 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 288 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 320 >dbj|GAY42664.1| hypothetical protein CUMW_068650 [Citrus unshiu] Length = 388 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|KDO70988.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] gb|KDO70989.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 388 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|ESR38875.1| hypothetical protein CICLE_v10025723mg [Citrus clementina] Length = 388 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|ESR38877.1| hypothetical protein CICLE_v10025723mg [Citrus clementina] Length = 401 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|KDO70987.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 409 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 288 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 320 >dbj|GAY42660.1| hypothetical protein CUMW_068650 [Citrus unshiu] dbj|GAY42661.1| hypothetical protein CUMW_068650 [Citrus unshiu] dbj|GAY42662.1| hypothetical protein CUMW_068650 [Citrus unshiu] Length = 413 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|KDO70984.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] gb|KDO70985.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] gb|KDO70986.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 413 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >ref|XP_006466832.1| PREDICTED: GTPase Era [Citrus sinensis] Length = 413 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >ref|XP_006425634.1| GTPase ERA-like, chloroplastic [Citrus clementina] gb|ESR38874.1| hypothetical protein CICLE_v10025723mg [Citrus clementina] Length = 413 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 292 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 324 >gb|KDO70983.1| hypothetical protein CISIN_1g014942mg [Citrus sinensis] Length = 415 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DI SEHPERFFVGEI+REKIFMQYRNEVPYACQ Sbjct: 294 DIVSEHPERFFVGEIIREKIFMQYRNEVPYACQ 326 >ref|XP_012845273.1| PREDICTED: GTPase Era, mitochondrial [Erythranthe guttata] gb|EYU31192.1| hypothetical protein MIMGU_mgv1a007062mg [Erythranthe guttata] Length = 421 Score = 70.9 bits (172), Expect = 2e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 465 DITSEHPERFFVGEIVREKIFMQYRNEVPYACQ 367 DITSEHPERFFV EIVREKIFMQYRNEVPYACQ Sbjct: 300 DITSEHPERFFVAEIVREKIFMQYRNEVPYACQ 332