BLASTX nr result
ID: Ophiopogon24_contig00014710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014710 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP70455.1| Retrovirus-related Pol polyprotein from transposo... 56 2e-07 gb|PPZ39178.1| hypothetical protein C5P26_26305, partial [Escher... 56 5e-07 gb|ABG22119.1| polyprotein, partial [Cynara cardunculus var. sco... 58 9e-07 gb|KYP60297.1| Retrovirus-related Pol polyprotein from transposo... 57 1e-06 dbj|BAT89465.1| hypothetical protein VIGAN_06042100, partial [Vi... 54 1e-06 gb|PKI65886.1| hypothetical protein CRG98_013706 [Punica granatum] 56 1e-06 gb|KYP42039.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|PKI73574.1| hypothetical protein CRG98_006022 [Punica granatum] 55 1e-06 gb|KYP53356.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|KYP72919.1| Retrovirus-related Pol polyprotein from transposo... 58 2e-06 gb|KYP48513.1| Retrovirus-related Pol polyprotein from transposo... 58 2e-06 gb|PKI64997.1| hypothetical protein CRG98_014621 [Punica granatum] 56 2e-06 gb|EXX50149.1| gag-pol fusion protein [Rhizophagus irregularis D... 58 2e-06 gb|ABO36622.1| copia LTR rider [Solanum lycopersicum] >gi|133711... 58 2e-06 gb|PKI67261.1| hypothetical protein CRG98_012333 [Punica granatum] 56 2e-06 gb|PKI40164.1| hypothetical protein CRG98_039447 [Punica granatum] 57 2e-06 gb|OAE19114.1| hypothetical protein AXG93_2062s1250 [Marchantia ... 56 3e-06 gb|PPZ26810.1| hypothetical protein C5P36_26435, partial [Escher... 56 3e-06 gb|KYP31853.1| Retrovirus-related Pol polyprotein from transposo... 57 3e-06 gb|PPY93112.1| hypothetical protein C5P31_25365, partial [Escher... 57 4e-06 >gb|KYP70455.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 63 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYAL 4 MSRVPYASAVGSLMYAMVCTRPD+AY + Sbjct: 32 MSRVPYASAVGSLMYAMVCTRPDIAYVV 59 >gb|PPZ39178.1| hypothetical protein C5P26_26305, partial [Escherichia coli] Length = 124 Score = 56.2 bits (134), Expect = 5e-07 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYALS 1 +M+R+PYASA+GSLMYAM+CTRPD+AYA+S Sbjct: 72 KMARIPYASAIGSLMYAMLCTRPDIAYAVS 101 >gb|ABG22119.1| polyprotein, partial [Cynara cardunculus var. scolymus] Length = 358 Score = 58.2 bits (139), Expect = 9e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSRVPY+SAVGSLMYAM+CTRPDLAYA+S Sbjct: 184 MSRVPYSSAVGSLMYAMICTRPDLAYAVS 212 >gb|KYP60297.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 183 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYAL 4 EM RVPYAS VGSLMYAMVCTRPD+AYA+ Sbjct: 31 EMERVPYASTVGSLMYAMVCTRPDIAYAI 59 >dbj|BAT89465.1| hypothetical protein VIGAN_06042100, partial [Vigna angularis var. angularis] Length = 81 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYAL 4 EM++VPY+SAVGSLMYAMVCTRPD+ YA+ Sbjct: 31 EMNKVPYSSAVGSLMYAMVCTRPDIGYAV 59 >gb|PKI65886.1| hypothetical protein CRG98_013706 [Punica granatum] Length = 154 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSR+PYASA+GS+MYAM+CTRPD++YALS Sbjct: 1 MSRIPYASAIGSIMYAMLCTRPDVSYALS 29 >gb|KYP42039.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 394 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MS VPYASAVGSLMYAMVCTRPDLAYA+S Sbjct: 169 MSHVPYASAVGSLMYAMVCTRPDLAYAVS 197 >gb|PKI73574.1| hypothetical protein CRG98_006022 [Punica granatum] Length = 125 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSR+PYASA+GS+MYAM+CTRPD+ YALS Sbjct: 1 MSRIPYASAIGSIMYAMLCTRPDVLYALS 29 >gb|KYP53356.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 503 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MS VPYASAVGSLMYAMVCTRPDLAYA+S Sbjct: 278 MSHVPYASAVGSLMYAMVCTRPDLAYAVS 306 >gb|KYP72919.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 865 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MS VPYASAVGSLMYAMVCTRPDLAYA+S Sbjct: 640 MSHVPYASAVGSLMYAMVCTRPDLAYAVS 668 >gb|KYP48513.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1032 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MS VPYASAVGSLMYAMVCTRPDLAYA+S Sbjct: 807 MSHVPYASAVGSLMYAMVCTRPDLAYAVS 835 >gb|PKI64997.1| hypothetical protein CRG98_014621 [Punica granatum] Length = 169 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSR+PYASA+GS+MYAM+CTRPD++YALS Sbjct: 1 MSRIPYASAIGSIMYAMLCTRPDVSYALS 29 >gb|EXX50149.1| gag-pol fusion protein [Rhizophagus irregularis DAOM 197198w] Length = 1303 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYALS 1 EMSRVPYASAVGS+MYAM CTRPD+A+ALS Sbjct: 1071 EMSRVPYASAVGSIMYAMTCTRPDVAFALS 1100 >gb|ABO36622.1| copia LTR rider [Solanum lycopersicum] gb|ABO36636.1| copia LTR rider [Solanum lycopersicum] Length = 1307 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSRVPYASAVGSLMYAMVCTRPDLA+A+S Sbjct: 1087 MSRVPYASAVGSLMYAMVCTRPDLAHAVS 1115 >gb|PKI67261.1| hypothetical protein CRG98_012333 [Punica granatum] Length = 174 Score = 55.8 bits (133), Expect = 2e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSR+PYASA+GS+MYAM+CTRPD++YALS Sbjct: 22 MSRIPYASAIGSIMYAMLCTRPDVSYALS 50 >gb|PKI40164.1| hypothetical protein CRG98_039447 [Punica granatum] Length = 263 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYALS 1 EM++VPYASA+GSLMYAM+CTRPD+AYA+S Sbjct: 162 EMAQVPYASAIGSLMYAMLCTRPDIAYAVS 191 >gb|OAE19114.1| hypothetical protein AXG93_2062s1250 [Marchantia polymorpha subsp. ruderalis] Length = 207 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 87 MSRVPYASAVGSLMYAMVCTRPDLAYALS 1 MSRVPYASAVGSLMYA VCTRPDLA+A+S Sbjct: 112 MSRVPYASAVGSLMYATVCTRPDLAFAVS 140 >gb|PPZ26810.1| hypothetical protein C5P36_26435, partial [Escherichia coli] Length = 242 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYALS 1 +M+R+PYASA+GSLMYAM+CTRPD+AYA+S Sbjct: 176 KMARIPYASAIGSLMYAMLCTRPDIAYAVS 205 >gb|KYP31853.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1314 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYAL 4 EMS+VPY+SAVGSLMYAMVCTRPD+AYA+ Sbjct: 1089 EMSKVPYSSAVGSLMYAMVCTRPDIAYAV 1117 >gb|PPY93112.1| hypothetical protein C5P31_25365, partial [Escherichia coli] Length = 813 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = -1 Query: 90 EMSRVPYASAVGSLMYAMVCTRPDLAYALS 1 +M+R+PYASA+GSLMYAM+CTRPD+AYA+S Sbjct: 598 KMARIPYASAIGSLMYAMLCTRPDIAYAIS 627