BLASTX nr result
ID: Ophiopogon24_contig00014692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014692 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79702.1| uncharacterized protein A4U43_C01F9170 [Asparagus... 90 5e-18 ref|XP_020254178.1| uncharacterized protein LOC109831252 [Aspara... 88 3e-17 ref|XP_008810464.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 74 3e-12 gb|OVA00577.1| Amidohydrolase 1 [Macleaya cordata] 73 4e-12 gb|ONM33419.1| Allantoinase [Zea mays] 66 1e-11 ref|XP_020080038.1| uncharacterized protein LOC109703725 [Ananas... 71 2e-11 ref|XP_019709562.1| PREDICTED: uncharacterized protein LOC105054... 70 4e-11 gb|PIA41276.1| hypothetical protein AQUCO_02300203v1 [Aquilegia ... 69 6e-11 gb|OIW13685.1| hypothetical protein TanjilG_08027 [Lupinus angus... 69 7e-11 ref|XP_019440254.1| PREDICTED: allantoinase [Lupinus angustifolius] 69 7e-11 gb|AAR29343.1| allantoinase [Robinia pseudoacacia] 69 7e-11 gb|PIA41271.1| hypothetical protein AQUCO_02300203v1 [Aquilegia ... 69 8e-11 gb|PIA41272.1| hypothetical protein AQUCO_02300203v1 [Aquilegia ... 69 1e-10 gb|PIA41273.1| hypothetical protein AQUCO_02300203v1 [Aquilegia ... 69 1e-10 gb|PIA41275.1| hypothetical protein AQUCO_02300203v1 [Aquilegia ... 69 1e-10 ref|XP_020221273.1| allantoinase-like [Cajanus cajan] >gi|101235... 69 1e-10 dbj|GAV77921.1| Amidohydro_1 domain-containing protein [Cephalot... 68 2e-10 gb|AQK47301.1| Allantoinase [Zea mays] 66 2e-10 dbj|GAU47742.1| hypothetical protein TSUD_387010 [Trifolium subt... 68 2e-10 gb|PNY12025.1| allantoinase [Trifolium pratense] 68 2e-10 >gb|ONK79702.1| uncharacterized protein A4U43_C01F9170 [Asparagus officinalis] Length = 507 Score = 89.7 bits (221), Expect = 5e-18 Identities = 44/51 (86%), Positives = 44/51 (86%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAKETPILAKGTVVE 294 AYMGKRLSGKVLATFV GNLVYGDEKHAPRACG PILAKE PI AK VE Sbjct: 457 AYMGKRLSGKVLATFVGGNLVYGDEKHAPRACGAPILAKERPIFAKEIAVE 507 >ref|XP_020254178.1| uncharacterized protein LOC109831252 [Asparagus officinalis] Length = 1468 Score = 87.8 bits (216), Expect = 3e-17 Identities = 43/50 (86%), Positives = 43/50 (86%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAKETPILAKGTVV 297 AYMGKRLSGKVLATFV GNLVYGDEKHAPRACG PILAKE PI AK V Sbjct: 457 AYMGKRLSGKVLATFVGGNLVYGDEKHAPRACGAPILAKERPIFAKEIAV 506 >ref|XP_008810464.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103721871 [Phoenix dactylifera] Length = 1716 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 443 YMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAKETP 321 YMGKRLSGKVLATFVRGNLVY KHAP ACG+PILAK P Sbjct: 466 YMGKRLSGKVLATFVRGNLVYSTGKHAPAACGVPILAKSVP 506 >gb|OVA00577.1| Amidohydrolase 1 [Macleaya cordata] Length = 500 Score = 72.8 bits (177), Expect = 4e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMGKRLSGKVLATFVRGNLVY + KHAP ACG+PILAK Sbjct: 462 AYMGKRLSGKVLATFVRGNLVYKEGKHAPAACGVPILAK 500 >gb|ONM33419.1| Allantoinase [Zea mays] Length = 74 Score = 66.2 bits (160), Expect = 1e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AY+GK+LSGKVL+TFVRGNLV+ ++KHA ACG+PILAK Sbjct: 36 AYLGKQLSGKVLSTFVRGNLVFAEDKHANAACGVPILAK 74 >ref|XP_020080038.1| uncharacterized protein LOC109703725 [Ananas comosus] Length = 1477 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AY+GKRLSGKVLATFVRGNLVY + KHAP ACG+PILAK Sbjct: 483 AYVGKRLSGKVLATFVRGNLVYTEGKHAPAACGVPILAK 521 >ref|XP_019709562.1| PREDICTED: uncharacterized protein LOC105054914 [Elaeis guineensis] Length = 1462 Score = 70.1 bits (170), Expect = 4e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 443 YMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 YMG RLSGKVLATFVRGN+VYG KHAP ACG+PILAK Sbjct: 469 YMGMRLSGKVLATFVRGNIVYGRGKHAPEACGVPILAK 506 >gb|PIA41276.1| hypothetical protein AQUCO_02300203v1 [Aquilegia coerulea] Length = 311 Score = 68.9 bits (167), Expect = 6e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG RLSGKVLATFVRGNLVY + +HAP ACG+PILAK Sbjct: 273 AYMGTRLSGKVLATFVRGNLVYKEGEHAPAACGVPILAK 311 >gb|OIW13685.1| hypothetical protein TanjilG_08027 [Lupinus angustifolius] Length = 483 Score = 69.3 bits (168), Expect = 7e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG+RLSGKVL TFVRGNLV+ D KHAP ACG+PILAK Sbjct: 445 AYMGRRLSGKVLDTFVRGNLVFRDGKHAPAACGVPILAK 483 >ref|XP_019440254.1| PREDICTED: allantoinase [Lupinus angustifolius] Length = 511 Score = 69.3 bits (168), Expect = 7e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG+RLSGKVL TFVRGNLV+ D KHAP ACG+PILAK Sbjct: 473 AYMGRRLSGKVLDTFVRGNLVFRDGKHAPAACGVPILAK 511 >gb|AAR29343.1| allantoinase [Robinia pseudoacacia] Length = 512 Score = 69.3 bits (168), Expect = 7e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG+RLSGKVL TFVRGNLV+ D KHAP ACG+PILAK Sbjct: 474 AYMGRRLSGKVLDTFVRGNLVFKDGKHAPAACGVPILAK 512 >gb|PIA41271.1| hypothetical protein AQUCO_02300203v1 [Aquilegia coerulea] Length = 380 Score = 68.9 bits (167), Expect = 8e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG RLSGKVLATFVRGNLVY + +HAP ACG+PILAK Sbjct: 342 AYMGTRLSGKVLATFVRGNLVYKEGEHAPAACGVPILAK 380 >gb|PIA41272.1| hypothetical protein AQUCO_02300203v1 [Aquilegia coerulea] Length = 468 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG RLSGKVLATFVRGNLVY + +HAP ACG+PILAK Sbjct: 430 AYMGTRLSGKVLATFVRGNLVYKEGEHAPAACGVPILAK 468 >gb|PIA41273.1| hypothetical protein AQUCO_02300203v1 [Aquilegia coerulea] Length = 486 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG RLSGKVLATFVRGNLVY + +HAP ACG+PILAK Sbjct: 448 AYMGTRLSGKVLATFVRGNLVYKEGEHAPAACGVPILAK 486 >gb|PIA41275.1| hypothetical protein AQUCO_02300203v1 [Aquilegia coerulea] Length = 504 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG RLSGKVLATFVRGNLVY + +HAP ACG+PILAK Sbjct: 466 AYMGTRLSGKVLATFVRGNLVYKEGEHAPAACGVPILAK 504 >ref|XP_020221273.1| allantoinase-like [Cajanus cajan] gb|KYP62933.1| putative allantoinase 1 [Cajanus cajan] Length = 512 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMGKR SGKVL TFVRGNLV+ D KHAP ACG+PILAK Sbjct: 474 AYMGKRFSGKVLDTFVRGNLVFKDGKHAPAACGVPILAK 512 >dbj|GAV77921.1| Amidohydro_1 domain-containing protein [Cephalotus follicularis] Length = 506 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILA 333 AY+GKRLSGKVLATFVRGNLVY + KHAP ACG PILA Sbjct: 468 AYLGKRLSGKVLATFVRGNLVYEEGKHAPAACGTPILA 505 >gb|AQK47301.1| Allantoinase [Zea mays] Length = 199 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AY+GK+LSGKVL+TFVRGNLV+ ++KHA ACG+PILAK Sbjct: 161 AYLGKQLSGKVLSTFVRGNLVFAEDKHANAACGVPILAK 199 >dbj|GAU47742.1| hypothetical protein TSUD_387010 [Trifolium subterraneum] Length = 379 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AY+G+RLSGKV TFVRGNLVY D KHAP ACG+PILAK Sbjct: 341 AYIGRRLSGKVFNTFVRGNLVYKDGKHAPSACGVPILAK 379 >gb|PNY12025.1| allantoinase [Trifolium pratense] Length = 449 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 446 AYMGKRLSGKVLATFVRGNLVYGDEKHAPRACGIPILAK 330 AYMG+RLSGKV TFVRGNLV+ D KHAP ACG+PILAK Sbjct: 411 AYMGRRLSGKVFDTFVRGNLVFKDGKHAPAACGVPILAK 449