BLASTX nr result
ID: Ophiopogon24_contig00014527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014527 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PCJ26461.1| hypothetical protein COA94_04970, partial [Ricket... 52 2e-06 ref|XP_020272734.1| glycine-rich domain-containing protein 1 [As... 55 6e-06 gb|ONK65372.1| uncharacterized protein A4U43_C07F36430 [Asparagu... 55 6e-06 >gb|PCJ26461.1| hypothetical protein COA94_04970, partial [Rickettsiales bacterium] Length = 61 Score = 52.0 bits (123), Expect = 2e-06 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -2 Query: 131 WLRQWLWKYGECRFCWLQRWLWQWVWKYDSECRFSWLWQWLRK 3 WL +WLW + R+ W WLW+W+W + + WLW+W+RK Sbjct: 2 WLWRWLWLW-LWRWLWRLLWLWRWLWLWRWRWLWRWLWRWIRK 43 >ref|XP_020272734.1| glycine-rich domain-containing protein 1 [Asparagus officinalis] Length = 736 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 391 EDRFVLPTILLLFILKKEGYTGENIKQISSPEVKT 287 ED+FVLP ILLLFILKKEG TG+NIKQ+++ E KT Sbjct: 620 EDQFVLPAILLLFILKKEGLTGKNIKQMANQESKT 654 >gb|ONK65372.1| uncharacterized protein A4U43_C07F36430 [Asparagus officinalis] Length = 811 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 391 EDRFVLPTILLLFILKKEGYTGENIKQISSPEVKT 287 ED+FVLP ILLLFILKKEG TG+NIKQ+++ E KT Sbjct: 679 EDQFVLPAILLLFILKKEGLTGKNIKQMANQESKT 713