BLASTX nr result
ID: Ophiopogon24_contig00014352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014352 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 58 4e-07 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 205 SDDPTLADCKIYLSKMQAFTISHIHREGNAGADFMANLGC-VAADYMWDSNFPPELMSII 381 +D P L +CK +S ++ + ISHI RE NA D +AN+GC + +W+ P L++ + Sbjct: 159 TDSPILVNCKSIISSIEEYKISHIFREVNASGDLLANMGCGTTSSILWEFEIPGTLLASV 218 Query: 382 RRDM 393 RDM Sbjct: 219 ERDM 222